1EZ3: Neuronal T-snare syntaxin-1A

Crystal structure of the neuronal T-snare syntaxin-1A. Determined by X-ray diffraction at 1.9 Å resolution. Released 7 Jun 2000.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Rattus norvegicus
Chains: 3
Atoms: 3,490
Mol. weight: 44.94 kDa
Released: 7 Jun 2000

Explore 1EZ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EZ3 contains 9 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	28-63	36
α-helix	69-104	36
α-helix	111-146	36

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	28-62	35
α-helix	69-104	36
α-helix	111-145	35

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	29-63	35
α-helix	69-103	35
α-helix	111-146	36

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Syntaxin-1A	A, B, C	protein	127	Rattus norvegicus	P32851 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1EZ3_1 SYNTAXIN-1A (chains A, B, C)
VDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIK
KTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRE
RCKGRIQ

Primary citation

Structural analysis of the neuronal SNARE protein syntaxin-1A. Lerman, J.C., Robblee, J., Fairman, R. et al. Biochemistry (2000) 39:8470-8479. DOI 10.1021/bi0003994 · PubMed

Other PDB entries of the same protein (UniProt P32851 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1N7S 1.45 Å, High Resolution Structure of a Truncated Neuronal SNARE Complex
5W5C 1.85 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2AB complex
1JTH 2.0 Å, Crystal structure and biophysical properties of a complex between the N-terminal region…
1URQ 2.0 Å, Crystal structure of neuronal Q-SNAREs in complex with R-SNARE motif of Tomosyn
6WVW 2.11 Å, Crystal structure of the R59P-SNAP25 containing SNARE complex
3RK2 2.2 Å, Truncated SNARE complex
1KIL 2.3 Å, Three-dimensional structure of the complexin/SNARE complex
1HVV 2.4 Å, Self-association of the H3 region of syntaxin 1A: implications for snare complex assembly
1SFC 2.4 Å, Neuronal synaptic fusion complex
5W5D 2.5 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2B complex
4JEH 2.5 Å, Crystal Structure of Munc18a and Syntaxin1 lacking N-peptide complex
3C98 2.6 Å, Revised structure of the munc18a-syntaxin1 complex

Browse structure collections

About this viewer

MolViewer shows 1EZ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.