1HVV: Syntaxin 1A

Self-association of the H3 region of syntaxin 1A: implications for snare complex assembly. Determined by X-ray diffraction at 2.4 Å resolution. Released 31 Jan 2001.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 2,141
Mol. weight: 35.58 kDa
Ligands: TAR
Released: 31 Jan 2001

Explore 1HVV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HVV contains 5 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	194-253	60

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	194-252	59

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	194-210	17
α-helix	212-253	42

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	194-249	56

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Syntaxin 1A	A, B, C, D	protein	75	Rattus norvegicus	P32851 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1HVV_1 SYNTAXIN 1A (chains A, B, C, D)
QALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVS
DTKKAVKYQSKARRK

Ligands and cofactors

ID	Name	Formula	Copies
TAR	D(-)-tartaric acid	C4 H6 O6	1

Primary citation

Self-association of the H3 region of syntaxin 1A. Implications for intermediates in SNARE complex assembly. Misura, K.M., Scheller, R.H., Weis, W.I. J Biol Chem (2001) 276:13273-13282. DOI 10.1074/jbc.M009636200 · PubMed

Other PDB entries of the same protein (UniProt P32851 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1N7S 1.45 Å, High Resolution Structure of a Truncated Neuronal SNARE Complex
5W5C 1.85 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2AB complex
1EZ3 1.9 Å, Crystal structure of the neuronal T-snare syntaxin-1A
1JTH 2.0 Å, Crystal structure and biophysical properties of a complex between the N-terminal region…
1URQ 2.0 Å, Crystal structure of neuronal Q-SNAREs in complex with R-SNARE motif of Tomosyn
6WVW 2.11 Å, Crystal structure of the R59P-SNAP25 containing SNARE complex
3RK2 2.2 Å, Truncated SNARE complex
1KIL 2.3 Å, Three-dimensional structure of the complexin/SNARE complex
1SFC 2.4 Å, Neuronal synaptic fusion complex
5W5D 2.5 Å, Crystal structure of the primed SNARE-Complexin-Synaptotagmin-1 C2B complex
4JEH 2.5 Å, Crystal Structure of Munc18a and Syntaxin1 lacking N-peptide complex
3C98 2.6 Å, Revised structure of the munc18a-syntaxin1 complex

Browse structure collections

About this viewer

MolViewer shows 1HVV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.