The structure of the immunophilin-immunosuppressant FKBP12-rapamycin complex interacting with human frap. Determined by X-ray diffraction at 2.7 Å resolution. Released 23 Jul 1997.
Explore 1FAP in 3D Show helices and sheets RCSB PDB PDBe
1FAP contains 10 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 1 |
| β-strand | 21-30 | 10 | 1 |
| β-strand | 35-38 | 4 | 1 |
| α-helix | 39-42 | 4 | |
| β-strand | 46-49 | 4 | 1 |
| α-helix | 57-64 | 8 | |
| β-strand | 71-76 | 6 | 1 |
| α-helix | 78-80 | 3 | |
| β-strand | 87 | 1 | 2 |
| β-strand | 91 | 1 | 2 |
| β-strand | 97-106 | 10 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2023-2035 | 13 | |
| α-helix | 2036-2040 | 5 | |
| α-helix | 2041 | 1 | |
| α-helix | 2044-2049 | 6 | |
| α-helix | 2052-2060 | 9 | |
| α-helix | 2065-2091 | 27 | |
| α-helix | 2095-2110 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| FK506-binding protein | A | protein | 107 | Homo sapiens | P62942 (AlphaFold model) |
| Frap | B | protein | 95 | Homo sapiens | P42345 (AlphaFold model) |
>1FAP_1 FK506-BINDING PROTEIN (chains A) GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWE EGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
>1FAP_2 FRAP (chains B) RVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRD LMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
| ID | Name | Formula | Copies |
|---|---|---|---|
| RAP | Rapamycin immunosuppressant drug | C51 H79 N O13 | 1 |
Structure of the FKBP12-rapamycin complex interacting with the binding domain of human FRAP. Choi, J., Chen, J., Schreiber, S.L. et al. Science (1996) 273:239-242. PubMed
Other PDB entries of the same protein (UniProt P62942 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1FAP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.