1FEW: Smac/diablo

Crystal structure of smac/diablo. Determined by X-ray diffraction at 2.2 Å resolution. Released 13 Sept 2000.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,373
Mol. weight: 20.76 kDa
Released: 13 Sept 2000

Explore 1FEW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FEW contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	13-65	53
α-helix	71-118	48
α-helix	122-181	60

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Second mitochondria-derived activator of caspases	A	protein	184	Homo sapiens	Q9NR28 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1FEW_1 SECOND MITOCHONDRIA-DERIVED ACTIVATOR OF CASPASES (chains A)
AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYR
QYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTG
ADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELKQKTQEEGEERAESEQEAY
LRED

Primary citation

Structural and biochemical basis of apoptotic activation by Smac/DIABLO. Chai, J., Du, C., Wu, J.W. et al. Nature (2000) 406:855-862. DOI 10.1038/35022514 · PubMed

Other PDB entries of the same protein (UniProt Q9NR28 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TW6 1.71 Å, Structure of an ML-IAP/XIAP chimera bound to a 9mer peptide derived from Smac
4TX5 1.8 Å, Crystal structure of Smac-DIABLO (in space group P65)
1G73 2.0 Å, Crystal structure of smac bound to xiap-BIR3 domain
1XB0 2.2 Å, Structure of the BIR domain of IAP-like protein 2
1OXQ 2.3 Å, Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of…
3D9U 2.3 Å, The BIR3 domain of cIAP1 in complex with the N terminal peptide from SMAC/DIABLO (AVPIAQ).
3UIH 2.4 Å, crystal structure of human Survivin in complex with Smac/DIABLO(1-15) peptide
1XB1 2.7 Å, The Structure of the BIR domain of IAP-like protein 2
3UIJ 2.71 Å, Crystal structure of human Survivin K62Y/H80W mutant in complex with Smac/DIABLO(1-15)…
6JX6 2.81 Å, Tetrameric form of Smac
8ATO 3.0 Å, Structure of the giant inhibitor of apoptosis, BIRC6 bound to the regulator SMAC
8E2I 3.04 Å, Cryo-EM structure of BIRC6/Smac

Browse structure collections

About this viewer

MolViewer shows 1FEW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.