8ATO: Giant inhibitor of apoptosis, BIRC6

Name: PDB 8ATO: Structure of the giant inhibitor of apoptosis, BIRC6 bound to the regulator SMAC
Published: 2023-03-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Structure of the giant inhibitor of apoptosis, BIRC6 bound to the regulator SMAC. Determined by electron microscopy at 3.0 Å resolution. Released 8 Mar 2023.

Method: Electron microscopy
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 46,909
Mol. weight: 1103.53 kDa
Released: 8 Mar 2023

Explore 8ATO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ATO contains 291 α-helices and 157 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 143 helices, 69 β-strands

Element	Residues	Length	Sheet
α-helix	82-84	3
β-strand	116-120	5	1
β-strand	125-129	5	1
β-strand	134-135	2	1
α-helix	140-142	3
α-helix	167-174	8
α-helix	175-179	5
α-helix	189-204	16
α-helix	212-216	5
α-helix	225-241	17
α-helix	248-261	14
α-helix	264-266	3
α-helix	282-284	3
α-helix	287-290	4
α-helix	306-312	7
β-strand	326-327	2	2
β-strand	334-335	2	2
α-helix	344-351	8
α-helix	356-359	4
α-helix	368-372	5
α-helix	417-418	2
α-helix	431-440	10
α-helix	564-565	2
β-strand	570	1	3
β-strand	630	1	3
α-helix	720-723	4
α-helix	724-728	5
β-strand	732	1	4
β-strand	736	1	5
β-strand	747	1	5
β-strand	750	1	4
β-strand	824	1	6
β-strand	848	1	6
α-helix	869-873	5
β-strand	903-906	4	7
β-strand	912-916	5	7
β-strand	921-926	6	7
β-strand	945	1	8
β-strand	952	1	8
α-helix	1019-1026	8
α-helix	1027-1029	3
β-strand	1031-1033	3	9
β-strand	1046-1048	3	9
α-helix	1049-1050	2
α-helix	1051-1057	7
β-strand	1077-1079	3	9
β-strand	1103-1109	7	9
α-helix	1178-1180	3
β-strand	1198-1199	2	9
α-helix	1206-1210	5
β-strand	1298-1306	9	9
α-helix	1314-1323	10
α-helix	1325-1336	12
β-strand	1339	1	10
β-strand	1342	1	10
α-helix	1344-1345	2
α-helix	1346-1364	19
α-helix	1371-1381	11
α-helix	1385-1390	6
α-helix	1391-1395	5
α-helix	1398-1417	20
α-helix	1422-1423	2
α-helix	1425-1434	10
α-helix	1436-1438	3
α-helix	1445-1458	14
α-helix	1464-1482	19
α-helix	1487-1496	10
β-strand	1511	1	11
β-strand	1516	1	11
β-strand	1522	1	12
β-strand	1526-1529	4	12
α-helix	1773-1774	2
β-strand	1777-1781	5	13
β-strand	1791-1806	16	12
β-strand	1814-1817	4	12
β-strand	1832-1835	4	12
β-strand	1842-1844	3	12
β-strand	1852-1859	8	12
β-strand	1870-1874	5	13
β-strand	1877-1881	5	12
α-helix	1913-1940	28
α-helix	1950-1957	8
α-helix	1961-1997	37
α-helix	2003-2005	3
α-helix	2011-2017	7
α-helix	2020-2040	21
α-helix	2049-2052	4
α-helix	2056-2066	11
α-helix	2072-2086	15
α-helix	2094-2103	10
α-helix	2114-2126	13
α-helix	2132-2145	14
α-helix	2165-2182	18
α-helix	2325-2339	15
β-strand	2347	1	14
α-helix	2348-2364	17
α-helix	2368-2370	3
α-helix	2371-2374	4
α-helix	2377-2388	12
β-strand	2389	1	15
β-strand	2394	1	16
β-strand	2397	1	16
α-helix	2402-2419	18
α-helix	2578-2599	22
α-helix	2636-2647	12
α-helix	2650-2652	3
β-strand	2655	1	15
α-helix	2657-2667	11
α-helix	2690-2692	3
α-helix	2698-2710	13
α-helix	2716-2731	16
α-helix	2745-2747	3
α-helix	2748-2754	7
α-helix	2756-2767	12
β-strand	2777	1	17
α-helix	2782-2801	20
α-helix	2805-2820	16
α-helix	2825-2828	4
α-helix	2833-2843	11
β-strand	2852	1	18
α-helix	2853-2872	20
β-strand	2877-2878	2	19
α-helix	2886-2888	3
β-strand	2891-2892	2	20
α-helix	2915-2930	16
β-strand	2935	1	18
β-strand	2940	1	18
α-helix	2980-2986	7
α-helix	2988-3000	13
β-strand	3002-3003	2	20
α-helix	3032-3045	14
α-helix	3050-3061	12
α-helix	3065-3067	3
α-helix	3079-3088	10
α-helix	3092-3100	9
α-helix	3103-3117	15
β-strand	3120	1	21
α-helix	3125-3132	8
β-strand	3161-3162	2	19
β-strand	3168-3170	3	19
α-helix	3177-3178	2
α-helix	3180-3183	4
β-strand	3197-3200	4	19
β-strand	3207-3227	21	19
α-helix	3232-3234	3
β-strand	3238-3244	7	19
β-strand	3252	1	19
α-helix	3256	1
β-strand	3257-3258	2	19
β-strand	3265-3283	19	19
α-helix	3284-3285	2
β-strand	3290-3301	12	19
α-helix	3322-3325	4
α-helix	3328-3339	12
α-helix	3342-3344	3
α-helix	3345-3352	8
α-helix	3358-3367	10
α-helix	3369-3370	2
α-helix	3375-3386	12
α-helix	3390-3401	12
α-helix	3406	1
α-helix	3429-3440	12
α-helix	3446-3465	20
α-helix	3491-3506	16
α-helix	3513-3516	4
α-helix	3519-3531	13
α-helix	3533	1
α-helix	3537-3552	16
α-helix	3554-3564	11
α-helix	3607-3616	10
α-helix	3620-3628	9
α-helix	3631-3643	13
α-helix	3683-3693	11
α-helix	3697-3703	7
α-helix	3709-3719	11
α-helix	3753-3771	19
α-helix	3775-3791	17
α-helix	3807-3815	9
β-strand	3821-3827	7	22
α-helix	3847-3849	3
β-strand	3855-3861	7	22
β-strand	3865	1	23
α-helix	3866-3873	8
β-strand	3965-3969	5	24
α-helix	3976-3978	3
β-strand	3982	1	23
α-helix	3983-3992	10
α-helix	3995-3996	2
β-strand	4001-4003	3	22
β-strand	4004-4008	5	24
α-helix	4065-4067	3
α-helix	4070-4076	7
α-helix	4079-4085	7
α-helix	4155-4165	11
α-helix	4170-4174	5
α-helix	4178-4187	10
β-strand	4193	1	25
β-strand	4199	1	25
α-helix	4200-4202	3
α-helix	4209-4211	3
α-helix	4212-4223	12
α-helix	4229-4240	12
α-helix	4243-4255	13
α-helix	4306-4331	26
α-helix	4358-4363	6
α-helix	4369-4378	10
α-helix	4384-4387	4
α-helix	4389-4404	16
α-helix	4409-4412	4
α-helix	4433-4444	12
α-helix	4445-4450	6
α-helix	4480-4500	21

Chain B: 141 helices, 88 β-strands

Element	Residues	Length	Sheet
β-strand	73-76	4	26
β-strand	81-85	5	26
β-strand	91-95	5	26
β-strand	129	1	27
β-strand	134	1	27
β-strand	160-166	7	28
α-helix	167-179	13
α-helix	189-204	16
α-helix	206-208	3
α-helix	211-215	5
β-strand	218-224	7	28
α-helix	225-242	18
α-helix	248-261	14
α-helix	264-266	3
α-helix	282-284	3
β-strand	285	1	29
α-helix	286-292	7
α-helix	293-295	3
α-helix	306-311	6
β-strand	314-316	3	30
β-strand	326-328	3	30
β-strand	335	1	30
α-helix	344-351	8
β-strand	366	1	29
α-helix	368-373	6
β-strand	378	1	27
β-strand	400-403	4	31
β-strand	409-412	4	31
β-strand	420-424	5	31
α-helix	431-440	10
β-strand	513	1	32
β-strand	566	1	32
β-strand	567	1	33
β-strand	570-575	6	34
β-strand	625-630	6	34
β-strand	633	1	33
α-helix	724-726	3
β-strand	746-750	5	35
β-strand	823-827	5	35
β-strand	847-849	3	35
β-strand	859-861	3	36
α-helix	864-867	4
β-strand	903-905	3	36
α-helix	926-929	4
β-strand	930	1	37
β-strand	937	1	37
β-strand	940-946	7	38
β-strand	951-956	6	38
β-strand	961	1	38
α-helix	1016-1017	2
α-helix	1019-1029	11
β-strand	1031	1	39
β-strand	1039-1041	3	40
β-strand	1046-1049	4	41
α-helix	1050	1
α-helix	1054-1056	3
α-helix	1061-1064	4
α-helix	1069-1073	5
β-strand	1075-1079	5	41
β-strand	1089	1	42
β-strand	1092-1094	3	40
β-strand	1101-1110	10	41
β-strand	1120-1122	3	43
α-helix	1125-1127	3
α-helix	1173-1176	4
β-strand	1186-1187	2	43
α-helix	1188-1191	4
β-strand	1192	1	41
β-strand	1198-1203	6	41
β-strand	1221	1	40
β-strand	1224	1	42
β-strand	1225-1226	2	43
α-helix	1292-1295	4
β-strand	1296-1305	10	41
β-strand	1306	1	39
α-helix	1307-1308	2
α-helix	1314-1323	10
α-helix	1326-1336	11
α-helix	1346-1362	17
α-helix	1371-1383	13
α-helix	1385-1394	10
α-helix	1398-1417	20
α-helix	1425-1434	10
α-helix	1436-1441	6
α-helix	1445-1457	13
α-helix	1458-1460	3
α-helix	1463-1483	21
α-helix	1487-1496	10
α-helix	1521	1
β-strand	1522	1	44
α-helix	1523-1524	2
β-strand	1526-1528	3	44
α-helix	1773-1774	2
β-strand	1788-1805	18	44
β-strand	1812-1820	9	44
α-helix	1824-1827	4
β-strand	1829-1834	6	44
β-strand	1843-1844	2	44
α-helix	1850-1851	2
β-strand	1852-1862	11	44
β-strand	1877-1881	5	44
α-helix	1910-1939	30
α-helix	1950-1957	8
α-helix	1961-1997	37
α-helix	2011-2017	7
α-helix	2020-2039	20
α-helix	2048-2053	6
α-helix	2056-2066	11
α-helix	2072-2086	15
α-helix	2094-2103	10
α-helix	2114-2127	14
α-helix	2128-2130	3
α-helix	2133-2145	13
α-helix	2147-2149	3
α-helix	2165-2183	19
α-helix	2325-2340	16
β-strand	2347	1	21
α-helix	2348-2364	17
α-helix	2371-2374	4
α-helix	2377-2388	12
β-strand	2389	1	45
β-strand	2394	1	46
β-strand	2397	1	46
α-helix	2401-2419	19
α-helix	2577-2598	22
α-helix	2636-2648	13
β-strand	2655	1	45
α-helix	2657-2668	12
α-helix	2690-2692	3
α-helix	2698-2710	13
α-helix	2716-2731	16
α-helix	2748-2754	7
α-helix	2756-2767	12
α-helix	2769-2771	3
β-strand	2777	1	19
α-helix	2782-2801	20
α-helix	2805-2819	15
α-helix	2825-2828	4
α-helix	2833-2844	12
β-strand	2852	1	47
α-helix	2853-2872	20
β-strand	2877-2879	3	17
β-strand	2891	1	48
α-helix	2915-2930	16
β-strand	2933-2934	2	49
β-strand	2940	1	47
β-strand	2978-2979	2	49
α-helix	2980-2986	7
α-helix	2988-2999	12
β-strand	3002	1	48
α-helix	3032-3046	15
α-helix	3050-3062	13
α-helix	3079-3088	10
α-helix	3092-3100	9
α-helix	3103-3117	15
β-strand	3120	1	14
α-helix	3126-3129	4
α-helix	3160	1
β-strand	3161-3162	2	17
β-strand	3168-3171	4	17
α-helix	3176-3178	3
α-helix	3180-3183	4
β-strand	3197-3200	4	17
α-helix	3201-3202	2
β-strand	3207-3227	21	17
α-helix	3232-3234	3
β-strand	3238-3244	7	17
β-strand	3252	1	17
α-helix	3256	1
β-strand	3257-3258	2	17
β-strand	3265-3283	19	17
α-helix	3284-3285	2
β-strand	3290-3301	12	17
α-helix	3306-3308	3
α-helix	3322-3325	4
α-helix	3328-3339	12
α-helix	3345-3352	8
α-helix	3358-3366	9
α-helix	3375-3386	12
α-helix	3390-3401	12
α-helix	3406	1
α-helix	3429-3440	12
α-helix	3446-3464	19
α-helix	3491-3506	16
α-helix	3513-3516	4
α-helix	3519-3530	12
α-helix	3537-3552	16
α-helix	3554-3564	11
α-helix	3607-3616	10
α-helix	3620-3628	9
α-helix	3634-3641	8
α-helix	3680-3693	14
α-helix	3698-3702	5
α-helix	3709-3720	12
α-helix	3753-3770	18
α-helix	3775-3789	15
α-helix	3807-3814	8
β-strand	3821-3827	7	50
α-helix	3847-3849	3
β-strand	3855-3861	7	50
β-strand	3865	1	51
α-helix	3866-3873	8
β-strand	3965-3966	2	52
α-helix	3970-3972	3
α-helix	3976-3978	3
β-strand	3982	1	51
α-helix	3983-3992	10
β-strand	4001-4004	4	50
β-strand	4007-4008	2	52
α-helix	4064-4067	4
α-helix	4070-4076	7
α-helix	4079-4086	8
α-helix	4155-4164	10
α-helix	4171-4174	4
α-helix	4179-4188	10
β-strand	4193	1	53
β-strand	4199	1	53
α-helix	4204-4206	3
α-helix	4212-4223	12
α-helix	4229-4240	12
α-helix	4243-4254	12
α-helix	4306-4331	26
α-helix	4359-4366	8
α-helix	4369-4378	10
α-helix	4382-4387	6
α-helix	4389-4404	16
α-helix	4409-4412	4
α-helix	4433-4450	18
α-helix	4481-4501	21

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	4-52	49
α-helix	59-80	22
α-helix	83-107	25
α-helix	110-149	40

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	3-52	50
α-helix	59-107	49
α-helix	111-147	37

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Baculoviral IAP repeat-containing protein 6	A, B	protein	4859	Homo sapiens	Q9NR09
Diablo IAP-binding mitochondrial protein	C, D	protein	184	Homo sapiens	Q9NR28 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8ATO_1 Baculoviral IAP repeat-containing protein 6 (chains A, B)
GPMVTGGGAAPPGTVTEPLPSVIVLSAGRKMAAAAAAASGPGCSSAAGAGAAGVSEWLVL
RDGCMHCDADGLHSLSYHPALNAILAVTSRGTIKVIDGTSGATLQASALSAKPGGQVKCQ
YISAVDKVIFVDDYAVGCRKDLNGILLLDTALQTPVSKQDDVVQLELPVTEAQQLLSACL
EKVDISSTEGYDLFITQLKDGLKNTSHETAANHKVAKWATVTFHLPHHVLKSIASAIVNE
LKKINQNVAALPVASSVMDRLSYLLPSARPELGVGPGRSVDRSLMYSEANRRETFTSWPH
VGYRWAQPDPMAQAGFYHQPASSGDDRAMCFTCSVCLVCWEPTDEPWSEHERHSPNCPFV
KGEHTQNVPLSVTLATSPAQFPCTDGTDRISCFGSGSCPHFLAAATKRGKICIWDVSKLM
KVHLKFEINAYDPAIVQQLILSGDPSSGVDSRRPTLAWLEDSSSCSDIPKLEGDSDDLLE
DSDSEEHSRSDSVTGHTSQKEAMEVSLDITALSILQQPEKLQWEIVANVLEDTVKDLEEL
GANPCLTNSKSEKTKEKHQEQHNIPFPCLLAGGLLTYKSPATSPISSNSHRSLDGLSRTQ
GESISEQGSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSLH
DDGFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAAANLTSPDSEKWNSVFPKPGTLVQ
CLRLPKFAEEENLCIDSITPCADGIHLLVGLRTCPVESLSAINQVEALNNLNKLNSALCN
RRKGELESNLAVVNGANISVIQHESPADVQTPLIIQPEQRNVSGGYLVLYKMNYATRIVT
LEEEPIKIQHIKDPQDTITSLILLPPDILDNREDDCEEPIEDMQLTSKNGFEREKTSDIS
TLGHLVITTQGGYVKILDLSNFEILAKVEPPKKEGTEEQDTFVSVIYCSGTDRLCACTKG
GELHFLQIGGTCDDIDEADILVDGSLSKGIEPSSEGSKPLSNPSSPGISGVDLLVDQPFT
LEILTSLVELTRFETLTPRFSATVPPCWVEVQQEQQQRRHPQHLHQQHHGDAAQHTRTWK
LQTDSNSWDEHVFELVLPKACMVGHVDFKFVLNSNITNIPQIQVTLLKNKAPGLGKVNAL
NIEVEQNGKPSLVDLNEEMQHMDVEESQCLRLCPFLEDHKEDILCGPVWLASGLDLSGHA
GMLTLTSPKLVKGMAGGKYRSFLIHVKAVNERGTEEICNGGMRPVVRLPSLKHQSNKGYS
LASLLAKVAAGKEKSSNVKNENTSGTRKSENLRGCDLLQEVSVTIRRFKKTSISKERVQR
CAMLQFSEFHEKLLNTLCRKTDDGQITEHAQSLVLDTLCWLAGVHSNGPGSSKEGNENLL
SKTRKFLSDIVRVCFFEAGRSIAHKCARFLALCISNGKCDPCQPAFGPVLLKALLDNMSF
LPAATTGGSVYWYFVLLNYVKDEDLAGCSTACASLLTAVSRQLQDRLTPMEALLQTRYGL
YSSPFDPVLFDLEMSGSSCKNVYNSSIGVQSDEIDLSDVLSGNGKVSSCTAAEGSFTSLT
GLLEVEPLHFTCVSTSDGTRIERDDAMSSFGVTPAVGGLSSGTVGEASTALSSAAQVALQ
SLSHAMASAEQQLQVLQEKQQQLLKLQQQKAKLEAKLHQTTAAAAAAASAVGPVHNSVPS
NPVAAPGFFIHPSDVIPPTPKTTPLFMTPPLTPPNEAVSVVINAELAQLFPGSVIDPPAV
NLAAHNKNSNKSRMNPLGSGLALAISHASHFLQPPPHQSIIIERMHSGARRFVTLDFGRP
ILLTDVLIPTCGDLASLSIDIWTLGEEVDGRRLVVATDISTHSLILHDLIPPPVCRFMKI
TVIGRYGSTNARAKIPLGFYYGHTYILPWESELKLMHDPLKGEGESANQPEIDQHLAMMV
ALQEDIQCRYNLACHRLETLLQSIDLPPLNSANNAQYFLRKPDKAVEEDSRVFSAYQDCI
QLQLQLNLAHNAVQRLKVALGASRKMLSETSNPEDLIQTSSTEQLRTIIRYLLDTLLSLL
HASNGHSVPAVLQSTFHAQACEELFKHLCISGTPKIRLHTGLLLVQLCGGERWWGQFLSN
VLQELYNSEQLLIFPQDRVFMLLSCIGQRSLSNSGVLESLLNLLDNLLSPLQPQLPMHRR
TEGVLDIPMISWVVMLVSRLLDYVATVEDEAAAAKKPLNGNQWSFINNNLHTQSLNRSSK
GSSSLDRLYSRKIRKQLVHHKQQLNLLKAKQKALVEQMEKEKIQSNKGSSYKLLVEQAKL
KQATSKHFKDLIRLRRTAEWSRSNLDTEVTTAKESPEIEPLPFTLAHERCISVVQKLVLF
LLSMDFTCHADLLLFVCKVLARIANATRPTIHLCEIVNEPQLERLLLLLVGTDFNRGDIS
WGGAWAQYSLTCMLQDILAGELLAPVAAEAMEEGTVGDDVGATAGDSDDSLQQSSVQLLE
TIDEPLTHDITGAPPLSSLEKDKEIDLELLQDLMEVDIDPLDIDLEKDPLAAKVFKPISS
TWYDYWGADYGTYNYNPYIGGLGIPVAKPPANTEKNGSQTVSVSVSQALDARLEVGLEQQ
AELMLKMMSTLEADSILQALTNTSPTLSQSPTGTDDSLLGGLQAANQTSQLIIQLSSVPM
LNVCFNKLFSMLQVHHVQLESLLQLWLTLSLNSSSTGNKENGADIFLYNANRIPVISLNQ
ASITSFLTVLAWYPNTLLRTWCLVLHSLTLMTNMQLNSGSSSAIGTQESTAHLLVSDPNL
IHVLVKFLSGTSPHGTNQHSPQVGPTATQAMQEFLTRLQVHLSSTCPQIFSEFLLKLIHI
LSTERGAFQTGQGPLDAQVKLLEFTLEQNFEVVSVSTISAVIESVTFLVHHYITCSDKVM
SRSGSDSSVGARACFGGLFANLIRPGDAKAVCGEMTRDQLMFDLLKLVNILVQLPLSGNR
EYSARVSVTTNTTDSVSDEEKVSGGKDGNGSSTSVQGSPAYVADLVLANQQIMSQILSAL
GLCNSSAMAMIIGASGLHLTKHENFHGGLDAISVGDGLFTILTTLSKKASTVHMMLQPIL
TYMACGYMGRQGSLATCQLSEPLLWFILRVLDTSDALKAFHDMGGVQLICNNMVTSTRAI
VNTARSMVSTIMKFLDSGPNKAVDSTLKTRILASEPDNAEGIHNFAPLGTITSSSPTAQP
AEVLLQATPPHRRARSAAWSYIFLPEEAWCDLTIHLPAAVLLKEIHIQPHLASLATCPSS
VSVEVSADGVNMLPLSTPVVTSGLTYIKIQLVKAEVASAVCLRLHRPRDASTLGLSQIKL
LGLTAFGTTSSATVNNPFLPSEDQVSKTSIGWLRLLHHCLTHISDLEGMMASAAAPTANL
LQTCAALLMSPYCGMHSPNIEVVLVKIGLQSTRIGLKLIDILLRNCAASGSDPTDLNSPL
LFGRLNGLSSDSTIDILYQLGTTQDPGTKDRIQALLKWVSDSARVAAMKRSGRMNYMCPN
SSTVEYGLLMPSPSHLHCVAAILWHSYELLVEYDLPALLDQELFELLFNWSMSLPCNMVL
KKAVDSLLCSMCHVHPNYFSLLMGWMGITPPPVQCHHRLSMTDDSKKQDLSSSLTDDSKN
AQAPLALTESHLATLASSSQSPEAIKQLLDSGLPSLLVRSLASFCFSHISSSESIAQSID
ISQDKLRRHHVPQQCNKMPITADLVAPILRFLTEVGNSHIMKDWLGGSEVNPLWTALLFL
LCHSGSTSGSHNLGAQQTSARSASLSSAATTGLTTQQRTAIENATVAFFLQCISCHPNNQ
KLMAQVLCELFQTSPQRGNLPTSGNISGFIRRLFLQLMLEDEKVTMFLQSPCPLYKGRIN
ATSHVIQHPMYGAGHKFRTLHLPVSTTLSDVLDRVSDTPSITAKLISEQKDDKEKKNHEE
KEKVKAENGFQDNYSVVVASGLKSQSKRAVSATPPRPPSRRGRTIPDKIGSTSGAEAANK
IITVPVFHLFHKLLAGQPLPAEMTLAQLLTLLYDRKLPQGYRSIDLTVKLGSRVITDPSL
SKTDSYKRLHPEKDHGDLLASCPEDEALTPGDECMDGILDESLLETCPIQSPLQVFAGMG
GLALIAERLPMLYPEVIQQVSAPVVTSTTQEKPKDSDQFEWVTIEQSGELVYEAPETVAA
EPPPIKSAVQTMSPIPAHSLAAFGLFLRLPGYAEVLLKERKHAQCLLRLVLGVTDDGEGS
HILQSPSANVLPTLPFHVLRSLFSTTPLTTDDGVLLRRMALEIGALHLILVCLSALSHHS
PRVPNSSVNQTEPQVSSSHNPTSTEEQQLYWAKGTGFGTGSTASGWDVEQALTKQRLEEE
HVTCLLQVLASYINPVSSAVNGEAQSSHETRGQNSNALPSVLLELLSQSCLIPAMSSYLR
NDSVLDMARHVPLYRALLELLRAIASCAAMVPLLLPLSTENGEEEEEQSECQTSVGTLLA
KMKTCVDTYTNRLRSKRENVKTGVKPDASDQEPEGLTLLVPDIQKTAEIVYAATTSLRQA
NQEKKLGEYSKKAAMKPKPLSVLKSLEEKYVAVMKKLQFDTFEMVSEDEDGKLGFKVNYH
YMSQVKNANDANSAARARRLAQEAVTLSTSLPLSSSSSVFVRCDEERLDIMKVLITGPAD
TPYANGCFEFDVYFPQDYPSSPPLVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRPE
EKWNPQTSSFLQVLVSVQSLILVAEPYFNEPGYERSRGTPSGTQSSREYDGNIRQATVKW
AMLEQIRNPSPCFKEVIHKHFYLKRVEIMAQCEEWIADIQQYSSDKRVGRTMSHHAAALK
RHTAQLREELLKLPCPEGLDPDTDDAPEVCRATTGAEETLMHDQVKPSSSKELPSDFQL

Sequence of entity 2 (C, D), FASTA

>8ATO_2 Diablo IAP-binding mitochondrial protein (chains C, D)
AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYR
QYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTG
ADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAY
LRED

Primary citation

Structural basis for SMAC-mediated antagonism of caspase inhibition by the giant ubiquitin ligase BIRC6. Dietz, L., Ellison, C.J., Riechmann, C. et al. Science (2023) 379:1112-1117. DOI 10.1126/science.ade8840 · PubMed

Other PDB entries of the same protein (UniProt Q9NR09), best resolution first:

8E2E 1.98 Å, Cryo-EM structure of helical arch of BIRC6 (from local refinement 1)
3CEG 2.01 Å, Crystal structure of the UBC domain of baculoviral IAP repeat-containing protein 6
8E2D 2.07 Å, Cryo-EM structure of BIRC6 (consensus)
8E2H 2.3 Å, Cryo-EM structure of C-terminal arm of BIRC6 (from local refinement 4)
8E2F 2.47 Å, Cryo-EM structure of N-terminal arm of BIRC6 (from local refinement 2)
8E2G 2.99 Å, Cryo-EM structure of N-terminal arm (aa68-966) of BIRC6 (from local refinement 3)
8E2I 3.04 Å, Cryo-EM structure of BIRC6/Smac
9QH5 3.09 Å, Consensus structure of UBA6-UbDha-BIRC6 trapped ternary complex (doubly loaded)
8E2K 3.21 Å, Cryo-EM structure of BIRC6/HtrA2-S306A
8ATM 3.3 Å, Structure of the giant inhibitor of apoptosis, BIRC6 (composite map)
8ATU 3.3 Å, Cryo-EM structure of human BIRC6
9XGB 3.3 Å, UBA6-BIRC6 ubc-ubt

Browse structure collections

About this viewer

MolViewer shows 8ATO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.