1FG9: Interferon gamma

3:1 complex of interferon-gamma receptor with interferon-gamma dimer. Determined by X-ray diffraction at 2.9 Å resolution. Released 11 Aug 2000.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 5
Atoms: 6,905
Mol. weight: 114.41 kDa
Released: 11 Aug 2000

Explore 1FG9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FG9 contains 33 α-helices and 60 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	20-23	4
α-helix	32-35	4
α-helix	39-58	20
α-helix	64-66	3
α-helix	67-81	15
α-helix	86-96	11
α-helix	105-111	7
α-helix	113-117	5

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	20-23	4
α-helix	32-35	4
α-helix	39-58	20
α-helix	67-81	15
α-helix	86-96	11
α-helix	105-111	7
α-helix	113-117	5
α-helix	122-123	2

Chain C: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	16-19	4	1
β-strand	22	1	2
β-strand	27	1	2
β-strand	28-32	5	1
α-helix	39-40	2
β-strand	41-48	8	3
β-strand	57-63	7	3
β-strand	67-69	3	1
α-helix	71-73	3
β-strand	81-88	8	3
β-strand	97-98	2	3
α-helix	99-101	3
β-strand	102	1	3
α-helix	104-107	4
α-helix	111-113	3
β-strand	114-117	4	4
β-strand	120	1	5
β-strand	123-124	2	5
β-strand	126-129	4	4
β-strand	152-161	10	6
β-strand	164-168	5	6
β-strand	171	1	6
β-strand	184	1	4
β-strand	187-188	2	5
β-strand	196-204	9	6
β-strand	210	1	6
α-helix	212-216	5
β-strand	217-219	3	6

Chain D: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	16-22	7	7
β-strand	27-32	6	7
β-strand	41-48	8	8
β-strand	57-63	7	8
β-strand	67-69	3	7
α-helix	71-73	3
β-strand	81-89	9	8
β-strand	92-93	2	8
β-strand	97-98	2	8
α-helix	99-101	3
β-strand	102	1	8
α-helix	104-107	4
α-helix	111-113	3
β-strand	114-117	4	9
β-strand	120	1	10
β-strand	123-124	2	10
β-strand	126-129	4	9
α-helix	130-131	2
β-strand	152-161	10	11
β-strand	164-168	5	11
β-strand	171	1	11
β-strand	184	1	9
β-strand	187-188	2	10
β-strand	196-204	9	11
β-strand	210	1	11
α-helix	212-216	5
β-strand	217-219	3	11

Chain E: 3 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	16-22	7	12
β-strand	27-32	6	12
β-strand	41-48	8	13
β-strand	57-63	7	13
β-strand	67-69	3	12
α-helix	71-73	3
β-strand	81-89	9	13
β-strand	92-93	2	13
β-strand	114-117	4	14
β-strand	120	1	15
β-strand	123-125	3	15
β-strand	126-129	4	14
α-helix	130-131	2
β-strand	152-161	10	6
β-strand	164-171	8	6
β-strand	186-188	3	15
β-strand	197-204	8	6
β-strand	210	1	6
α-helix	212-215	4
β-strand	216-218	3	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon gamma	A, B	protein	134	Homo sapiens	P01579 (AlphaFold model)
Interferon-gamma receptor alpha chain	C, D, E	protein	245	Homo sapiens	P15260 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1FG9_1 INTERFERON GAMMA (chains A, B)
MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKN
FKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAE
LSPAAKTGKRKRSQ

Sequence of entity 2 (C, D, E), FASTA

>1FG9_2 INTERFERON-GAMMA RECEPTOR ALPHA CHAIN (chains C, D, E)
EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDAC
INISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKE
EKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDE
IQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGSLWIPVVAALLL
FLVLS

Primary citation

Observation of an unexpected third receptor molecule in the crystal structure of human interferon-gamma receptor complex. Thiel, D.J., le Du, M.H., Walter, R.L. et al. Structure (2000) 8:927-936. DOI 10.1016/S0969-2126(00)00184-2 · PubMed

Other PDB entries of the same protein (UniProt P01579 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FYH 2.04 Å, 1:1 complex between an interferon gamma single-chain variant and its receptor
3BES 2.2 Å, Structure of a Poxvirus ifngbp/ifng Complex
1EKU 2.9 Å, Crystal structure of a biologically active single chain mutant of human ifn-gamma
9VNP 3.02 Å, The complexes of IFN-gamma and A01BM-03 Fab
6E3K 3.25 Å, Interferon gamma signalling complex with IFNGR1 and IFNGR2
1HIG 3.5 Å, Three-dimensional structure of recombinant human interferon-gamma.
6E3L 3.8 Å, Interferon gamma signalling complex with IFNGR1 and IFNGR2

Browse structure collections

About this viewer

MolViewer shows 1FG9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.