GRP1 PH domain with INS(1,3,4,5)P4. Determined by X-ray diffraction at 1.5 Å resolution. Released 23 Aug 2000.
Explore 1FGY in 3D Show helices and sheets RCSB PDB PDBe
1FGY contains 2 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 267-274 | 8 | 1 |
| β-strand | 281-289 | 9 | 1 |
| β-strand | 292-296 | 5 | 1 |
| β-strand | 306-309 | 4 | 1 |
| β-strand | 314-318 | 5 | 1 |
| β-strand | 326-330 | 5 | 1 |
| α-helix | 337-340 | 4 | |
| β-strand | 342-344 | 3 | 1 |
| β-strand | 350-352 | 3 | 1 |
| β-strand | 357-361 | 5 | 1 |
| α-helix | 365-381 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| GRP1 | A | protein | 127 | Mus musculus | O08967 (AlphaFold model) |
>1FGY_1 GRP1 (chains A) TFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVLD PRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASIS RDPFYDM
| ID | Name | Formula | Copies |
|---|---|---|---|
| 4IP | Inositol-(1,3,4,5)-tetrakisphosphate | C6 H16 O18 P4 | 1 |
Structural basis of 3-phosphoinositide recognition by pleckstrin homology domains. Lietzke, S.E., Bose, S., Cronin, T. et al. Mol Cell (2000) 6:385-394. DOI 10.1016/S1097-2765(00)00038-1 · PubMed
Other PDB entries of the same protein (UniProt O08967 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1FGY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.