1FT8: RNA-binding domain of the mRNA export factor tap

Crystal structure of the RNA-binding domain of the mRNA export factor tap. Determined by X-ray diffraction at 3.15 Å resolution. Released 11 Dec 2000.

Method: X-ray diffraction
Resolution: 3.15 Å
Organism: Homo sapiens
Chains: 5
Atoms: 6,913
Mol. weight: 154.01 kDa
Released: 11 Dec 2000

Explore 1FT8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FT8 contains 50 α-helices and 43 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	119-124	6	1
α-helix	127-129	3
α-helix	132-142	11
β-strand	150-155	6	1
β-strand	157-163	7	1
α-helix	166-173	8
β-strand	179-180	2	2
α-helix	185	1
β-strand	186-187	2	2
α-helix	188	1
β-strand	190-194	5	1
α-helix	206-218	13
β-strand	220-221	2	3
β-strand	226-228	3	3
α-helix	232-234	3
α-helix	250-263	14
β-strand	269-271	3	3
α-helix	280-283	4
α-helix	286-289	4
β-strand	295-297	3	3
α-helix	307-312	6
β-strand	319-321	3	3
α-helix	326-330	5
α-helix	334-344	11
β-strand	350-351	2	3
β-strand	354-355	2	3
α-helix	356-357	2

Chain B: 10 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	206-218	13
β-strand	220-221	2	4
β-strand	226-228	3	4
α-helix	232-234	3
α-helix	236-240	5
α-helix	250-263	14
β-strand	269-271	3	4
α-helix	280-283	4
α-helix	286-289	4
β-strand	295-297	3	4
α-helix	306-312	7
β-strand	319-321	3	4
α-helix	326-330	5
α-helix	334-342	9
β-strand	350-351	2	4
β-strand	354-355	2	4
α-helix	356-357	2

Chain C: 15 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	119-124	6	5
α-helix	127-129	3
α-helix	132-142	11
β-strand	150-155	6	5
β-strand	157-163	7	5
α-helix	166-173	8
β-strand	179-180	2	6
β-strand	186-187	2	6
α-helix	188	1
β-strand	190-194	5	5
α-helix	195-197	3
α-helix	204-205	2
α-helix	206-217	12
β-strand	220-221	2	7
β-strand	226-228	3	7
α-helix	236-241	6
α-helix	250-263	14
β-strand	269-271	3	7
α-helix	280-283	4
α-helix	286-289	4
β-strand	295-297	3	7
α-helix	307-312	6
β-strand	319-321	3	7
α-helix	326-330	5
α-helix	334-344	11
β-strand	350-351	2	7
β-strand	354-355	2	7
α-helix	356-357	2

Chain D: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	206-217	12
β-strand	220-221	2	8
α-helix	222-224	3
β-strand	226-228	3	8
α-helix	238-240	3
α-helix	250-263	14
β-strand	269-271	3	8
α-helix	280-283	4
α-helix	286-289	4
β-strand	295-297	3	8
α-helix	306-312	7
β-strand	319-321	3	8
α-helix	326-330	5
α-helix	334-344	11
β-strand	350-351	2	8
β-strand	354-355	2	8

Chain E: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	120-122	3	9
α-helix	132-142	11
β-strand	150	1	9
β-strand	161-163	3	9
α-helix	166-173	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tip associating protein	A, B, C, D, E	protein	271	Homo sapiens	Q9UBU9 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>1FT8_1 TIP ASSOCIATING PROTEIN (chains A, B, C, D, E)
PPERGGAGTSQDGTSKNWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQF
FVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYD
GSQQVLDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLD
DMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAI
RERFPKLLRLDGHELPPPIAFDVEAPTTLPP

Primary citation

The structure of the mRNA export factor TAP reveals a cis arrangement of a non-canonical RNP domain and an LRR domain. Liker, E., Fernandez, E., Izaurralde, E. et al. EMBO J (2000) 19:5587-5598. DOI 10.1093/emboj/19.21.5587 · PubMed

Other PDB entries of the same protein (UniProt Q9UBU9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OAI 1.0 Å, Complex between Tap UBA domain and FxFG nucleoporin peptide
9I8A 1.5 Å, NXT1-NXF1 complex crystallized in space group P65 2 2
1JKG 1.9 Å, Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain…
3RW6 2.3 Å, Structure of nuclear RNA export factor TAP bound to CTE RNA
2Z5K 2.6 Å, Complex of Transportin 1 with TAP NLS
1JN5 2.8 Å, Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain…
1FO1 2.9 Å, Crystal structure of the RNA-binding domain of the mRNA export factor tap
2Z5M 3.0 Å, Complex of Transportin 1 with TAP NLS, crystal form 2
3RW7 3.0 Å, Structure of N-terminal domain of nuclear RNA export factor TAP
4WYK 3.4 Å, Structure of the LRR and NTF2-like domains of NXF1 complexed with NXT1
1KOH 3.8 Å, The crystal structure and mutational analysis of a novel RNA-binding domain found in the…
1KOO 3.8 Å, The crystal structure and mutational analysis of a novel RNA-binding domain found in the…

Browse structure collections

About this viewer

MolViewer shows 1FT8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.