1FU1: Human XRCC4

Crystal structure of human XRCC4. Determined by X-ray diffraction at 2.7 Å resolution. Released 11 Dec 2000.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,177
Mol. weight: 47.81 kDa
Released: 11 Dec 2000

Explore 1FU1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FU1 contains 11 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	10	1	2
β-strand	18-24	7	1
α-helix	28-30	3
β-strand	31-37	7	1
β-strand	42-48	7	1
α-helix	49-58	10
α-helix	63-74	12
β-strand	84-88	5	2
β-strand	94-101	8	2
β-strand	104-112	9	2
β-strand	114-115	2	1
α-helix	116	1
α-helix	119-172	54

Chain B: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	402-410	9	3
β-strand	413-424	12	3
α-helix	428-430	3
β-strand	431-437	7	3
β-strand	442-448	7	3
α-helix	449-458	10
α-helix	463-474	12
β-strand	484-488	5	3
β-strand	494-501	8	3
β-strand	504-512	9	3
β-strand	514-515	2	3
α-helix	516	1
α-helix	519-556	38
α-helix	558-601	44

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein XRCC4	A, B	protein	203	Homo sapiens	Q13426 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1FU1_1 DNA REPAIR PROTEIN XRCC4 (chains A, B)
MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMA
MEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPA
EVIRELICYCLDTTAENQAKNEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRF
ILVLNEKKTKIRSLHNKLLNAAQ

Primary citation

Crystal structure of the Xrcc4 DNA repair protein and implications for end joining. Junop, M.S., Modesti, M., Guarne, A. et al. EMBO J (2000) 19:5962-5970. DOI 10.1093/emboj/19.22.5962 · PubMed

Other PDB entries of the same protein (UniProt Q13426 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5E50 1.38 Å, APLF/XRCC4 complex
7M3P 2.0 Å, Xrcc4-Spc110p(164-207) fusion
3MUD 2.2 Å, Structure of the Tropomyosin Overlap Complex from Chicken Smooth Muscle
1IK9 2.3 Å, Crystal structure of a XRCC4-DNA ligase IV complex
5CHX 2.3 Å, Crystal Structure of amino acids 1590-1657 of MYH7
5CJ0 2.3 Å, Crystal Structure of Amino Acids 1631-1692 of MYH7
4XA4 2.33 Å, Crystal Structure of the coiled-coil surrounding Skip 3 of MYH7
3II6 2.4 Å, Structure of human Xrcc4 in complex with the tandem BRCT domains of DNA LigaseIV.
5WJ7 2.5 Å, Crystal Structure of Amino Acids 1733-1797 of Human Beta Cardiac Myosin Fused to Xrcc4
6ABO 2.65 Å, human XRCC4 and IFFO1 complex
9CQ3 2.8 Å, The gap-filling complex with Pol mu engaged in the NHEJ pathway
9N81 2.8 Å, A gap-filling complex with Pol mu engaged in the NHEJ Pathway

Browse structure collections

About this viewer

MolViewer shows 1FU1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.