3MUD: PDB entry 3MUD

Structure of the Tropomyosin Overlap Complex from Chicken Smooth Muscle. Determined by X-ray diffraction at 2.2 Å resolution. Released 23 Jun 2010.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Homo sapiens, Gallus gallus
Chains: 4
Atoms: 3,833
Mol. weight: 56.79 kDa
Released: 23 Jun 2010

Explore 3MUD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3MUD contains 12 α-helices and 17 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	1
β-strand	13-24	12	1
α-helix	28-30	3
β-strand	31-37	7	1
β-strand	42-48	7	1
α-helix	49-58	10
α-helix	63-74	12
β-strand	84-88	5	1
β-strand	94-100	7	1
β-strand	105-112	8	1
β-strand	114-115	2	1
α-helix	116	1
α-helix	119-282	52

Chain B: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	2
β-strand	10	1	3
β-strand	18-24	7	2
α-helix	28-30	3
β-strand	31-37	7	2
β-strand	42-48	7	2
α-helix	49-59	11
α-helix	63-74	12
β-strand	83-89	7	3
β-strand	94-100	7	3
β-strand	105-112	8	3
β-strand	114-115	2	2
α-helix	116	1
α-helix	119-282	52

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	-1-222	39

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	-1-228	45

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein XRCC4,Tropomyosin alpha-1 chain	A, B	protein	175	Homo sapiens, Gallus gallus	P04268 (AlphaFold model), Q13426 (AlphaFold model)
Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1	C, D	protein	75	Homo sapiens	P09493 (AlphaFold model), Q15691 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3MUD_1 DNA repair protein XRCC4,Tropomyosin alpha-1 chain (chains A, B)
GGSGERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEAD
DMAMEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVE
NPAEVIRELICYCLDTTAKNEKSIDDLEEKVAHAKEENLNMHQMLDQTLLELNNM

Sequence of entity 2 (C, D), FASTA

>3MUD_2 Tropomyosin alpha-1 chain,Microtubule-associated protein RP/EB family member 1 (chains C, D)
GASMDAIKKKMQMLKLDKENALDRAEQAEADKDFYFGKLRNIELICQENEGENDPVLQRI
VDILYATDEGFVIPD

Primary citation

Structure of the tropomyosin overlap complex from chicken smooth muscle: insight into the diversity of N-terminal recognition . Frye, J., Klenchin, V.A., Rayment, I. Biochemistry (2010) 49:4908-4920. DOI 10.1021/bi100349a · PubMed

Other PDB entries of the same protein (UniProt P04268 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3U1C 1.8 Å, Anti-parallel dimer of N-terminal 98-aa fragment of smooth muscle tropomyosin alpha
1IC2 2.0 Å, Deciphering the design of the tropomyosin molecule
3U1A 2.0 Å, N-terminal 81-aa fragment of smooth muscle tropomyosin alpha
3MTU 2.1 Å, Structure of the Tropomyosin Overlap Complex from Chicken Smooth Muscle

Browse structure collections

About this viewer

MolViewer shows 3MUD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.