4XA4: Coiled-coil surrounding Skip 3 of MYH7

Crystal Structure of the coiled-coil surrounding Skip 3 of MYH7. Determined by X-ray diffraction at 2.33 Å resolution. Released 1 Jul 2015.

Method: X-ray diffraction
Resolution: 2.33 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,243
Mol. weight: 47.62 kDa
Released: 1 Jul 2015

Explore 4XA4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4XA4 contains 8 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	1
β-strand	13-24	12	1
α-helix	28-30	3
β-strand	32-37	6	1
β-strand	42-47	6	1
α-helix	49-57	9
α-helix	63-74	12
β-strand	83-88	6	1
β-strand	94-100	7	1
β-strand	105-112	8	1
β-strand	114-115	2	1
α-helix	119-1601	80

Chain B: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	2
β-strand	10	1	3
β-strand	18-24	7	2
β-strand	25	1	4
β-strand	27	1	4
α-helix	28-30	3
β-strand	32-37	6	2
β-strand	42-47	6	2
α-helix	49-58	10
α-helix	63-74	12
β-strand	83-88	6	3
β-strand	94-101	8	3
β-strand	104-112	9	3
β-strand	114-115	2	2
α-helix	119-1601	80

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Xrcc4-MYH7(1551-1609) chimera protein	A, B	protein	209	Homo sapiens	P12883 (AlphaFold model), Q13426 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4XA4_1 Xrcc4-MYH7(1551-1609) chimera protein (chains A, B)
GGSGERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEAD
DMAMEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVE
NPAEVIRELICYCLDTTAENQAKNEHLQKELEHEEGKILRAQLEFNQIKAEIERKLAEKD
EEMEQAKRNHLRVVDSLQTSLDAETRSRN

Primary citation

Skip residues modulate the structural properties of the myosin rod and guide thick filament assembly. Taylor, K.C., Buvoli, M., Korkmaz, E.N. et al. Proc Natl Acad Sci U S A (2015) 112:E3806-E3815. DOI 10.1073/pnas.1505813112 · PubMed

Other PDB entries of the same protein (UniProt P12883 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CJ1 2.1 Å, Crystal structure of the coiled coil of MYH7 residues 1526 to 1571 fused to Gp7
6PF2 2.17 Å, Crystal Structure of Amino Acids 1220-1276 of Human Beta Cardiac Myosin Fused to Gp7 and…
6PFP 2.2 Å, Crystal Structure of Amino Acids 1473-1536 of Human Beta Cardiac Myosin Fused to Gp7 and…
4PA0 2.25 Å, Omecamtiv Mercarbil binding site on the Human Beta-Cardiac Myosin Motor Domain
5CHX 2.3 Å, Crystal Structure of amino acids 1590-1657 of MYH7
5CJ0 2.3 Å, Crystal Structure of Amino Acids 1631-1692 of MYH7
5WME 2.3 Å, Crystal Structure of Amino Acids 1729-1786 of Human Beta Cardiac Myosin Fused to Gp7 as…
9HTF 2.48 Å, Beta-cardiac myosin Y115H mutant motor domain in the pre-powerstroke state, MgADP.VO4 form
2FXO 2.5 Å, Structure of the human beta-myosin S2 fragment
5WJ7 2.5 Å, Crystal Structure of Amino Acids 1733-1797 of Human Beta Cardiac Myosin Fused to Xrcc4
4XA3 2.55 Å, Crystal structure of the coiled-coil surrounding Skip 2 of MYH7
9HTG 2.6 Å, Beta-cardiac myosin E497D mutant motor domain in the pre-powerstroke state, MgADP.VO4 form

Browse structure collections

About this viewer

MolViewer shows 4XA4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.