Crystal Structure of amino acids 1590-1657 of MYH7. Determined by X-ray diffraction at 2.3 Å resolution. Released 2 Dec 2015.
Explore 5CHX in 3D Show helices and sheets RCSB PDB PDBe
5CHX contains 10 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-10 | 9 | 1 |
| β-strand | 13-24 | 12 | 1 |
| α-helix | 28-30 | 3 | |
| β-strand | 31-37 | 7 | 1 |
| β-strand | 42-48 | 7 | 1 |
| α-helix | 49-58 | 10 | |
| α-helix | 63-74 | 12 | |
| β-strand | 84-89 | 6 | 1 |
| β-strand | 94-100 | 7 | 1 |
| β-strand | 105-112 | 8 | 1 |
| β-strand | 114-115 | 2 | 1 |
| α-helix | 116 | 1 | |
| α-helix | 119-1655 | 91 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Xrcc4-MYH7-1590-1657 | A, B | protein | 214 | Homo sapiens | P12883 (AlphaFold model), Q13426 (AlphaFold model) |
>5CHX_1 Xrcc4-MYH7-1590-1657 (chains A, B) GGSGERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEAD DMAMEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVE NPAEVIRELICYCLDTTAENQAKNEHHLRVVDSLQTSLDAETRSRNEALRVKKKMEGDLN EMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQL
A composite approach towards a complete model of the myosin rod. Korkmaz, E.N., Taylor, K.C., Andreas, M.P. et al. Proteins (2016) 84:172-189. DOI 10.1002/prot.24964 · PubMed
Other PDB entries of the same protein (UniProt P12883 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5CHX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.