1FU9: U-shaped transcriptional cofactor

Name: PDB 1FU9: Solution structure of the ninth zinc-finger domain of the U-shaped transcription factor
Published: 2000-10-04
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Solution structure of the ninth zinc-finger domain of the U-shaped transcription factor. Determined by solution NMR. Released 4 Oct 2000.

Method: Solution NMR
Organism: Drosophila melanogaster
Chains: 1
Atoms: 292
Mol. weight: 4.24 kDa
Ligands: ZN
Released: 4 Oct 2000

Explore 1FU9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FU9 contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	1
β-strand	16-17	2	1
α-helix	21-30	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
U-shaped transcriptional cofactor	A	protein	36	Drosophila melanogaster	Q9VPQ6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1FU9_1 U-SHAPED TRANSCRIPTIONAL COFACTOR (chains A)
GSAAEVMKKYCSTCDISFNYVKTYLAHKQFYCKNKP

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Solution structures of two CCHC zinc fingers from the FOG family protein U-shaped that mediate protein-protein interactions. Liew, C.K., Kowalski, K., Fox, A.H. et al. Structure (2000) 8:1157-1166. DOI 10.1016/S0969-2126(00)00527-X · PubMed

Other PDB entries of the same protein (UniProt Q9VPQ6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FV5 Solution structure of the first zinc finger from the drosophila U-shaped transcription…
1JN7 Solution Structure of a CCHH mutant of the ninth CCHC Zinc Finger of U-shaped
1Y0J Zinc fingers as protein recognition motifs: structural basis for the GATA-1/Friend of…
2L6Z haddock model of GATA1NF:Lmo2LIM2-Ldb1LID with FOG

Browse structure collections

About this viewer

MolViewer shows 1FU9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.