2L6Z: Erythroid transcription factor

haddock model of GATA1NF:Lmo2LIM2-Ldb1LID with FOG. Determined by solution NMR. Released 31 Aug 2011.

Method: Solution NMR
Organisms: Mus musculus, Drosophila melanogaster
Chains: 3
Atoms: 1,320
Mol. weight: 19.21 kDa
Ligands: ZN
Released: 31 Aug 2011

Explore 2L6Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L6Z contains 9 α-helices and 15 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	216	1	1
β-strand	224	1	1
α-helix	228-232	5

Chain B: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	10	1	2
β-strand	17	1	2
α-helix	21-30	10

Chain C: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	93	1	3
α-helix	99	1
β-strand	100	1	3
α-helix	101	1
β-strand	108	1	4
β-strand	121	1	5
β-strand	122	1	6
α-helix	127	1
β-strand	128	1	5
α-helix	129	1
β-strand	134-135	2	7
β-strand	136-137	2	6
β-strand	142-143	2	6
α-helix	148-151	4
β-strand	169-170	2	7
α-helix	173	1
β-strand	174	1	4
α-helix	175-176	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Erythroid transcription factor	A	protein	39	Mus musculus	P17679 (AlphaFold model)
Zinc finger protein ush	B	protein	36	Drosophila melanogaster	Q9VPQ6 (AlphaFold model)
LIM domain only 2, linker, LIM domain-binding protein 1	C	protein	96	Mus musculus	P25801 (AlphaFold model), P70662 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L6Z_1 Erythroid transcription factor (chains A)
EARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQN

Sequence of entity 2 (B), FASTA

>2L6Z_2 Zinc finger protein ush (chains B)
GSLLKPARFMCLPCGIAFSSPSTLEAHQAYYCSHRI

Sequence of entity 3 (C), FASTA

>2L6Z_3 LIM domain only 2, linker, LIM domain-binding protein 1 (chains C)
YLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFSVGDRYLLINSDIV
CEQDIYEWTKINGGSGGSGGSGGDVMVVGEPTLMGG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Structural basis of simultaneous recruitment of the transcriptional regulators LMO2 and FOG1/ZFPM1 by the transcription factor GATA1. Wilkinson-White, L., Gamsjaeger, R., Dastmalchi, S. et al. Proc Natl Acad Sci U S A (2011) 108:14443-14448. DOI 10.1073/pnas.1105898108 · PubMed

Other PDB entries of the same protein (UniProt P17679 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VD6 1.98 Å, Both Zn Fingers of GATA1 Bound to Palindromic DNA Recognition Site, P21 Crystal Form
3VEK 2.63 Å, Both Zn Fingers of GATA1 Bound to Palindromic DNA Recognition Site, P1 Crystal Form
1GNF Solution structure of the N-terminal zinc finger of murine gata-1, NMR, 25 structures
1Y0J Zinc fingers as protein recognition motifs: structural basis for the GATA-1/Friend of…
2L5E Complex between BD1 of Brd3 and GATA-1 C-tail
2L6Y haddock model of GATA1NF:Lmo2LIM2-Ldb1LID

Browse structure collections

About this viewer

MolViewer shows 2L6Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.