1Y0J: Erythroid transcription factor

Zinc fingers as protein recognition motifs: structural basis for the GATA-1/Friend of GATA interaction. Determined by solution NMR. Released 25 Jan 2005.

Method: Solution NMR
Organisms: Mus musculus, Drosophila melanogaster
Chains: 2
Atoms: 583
Mol. weight: 9.29 kDa
Ligands: ZN
Released: 25 Jan 2005

Explore 1Y0J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Y0J contains 2 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	216-217	2	1
β-strand	223-224	2	1
α-helix	228-234	7

Chain B: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	10	1	2
β-strand	17	1	2
α-helix	21-27	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Erythroid transcription factor	A	protein	46	Mus musculus	P17679 (AlphaFold model)
Zinc-finger protein ush	B	protein	36	Drosophila melanogaster	Q9VPQ6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Y0J_1 Erythroid transcription factor (chains A)
GSEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIR

Sequence of entity 2 (B), FASTA

>1Y0J_2 Zinc-finger protein ush (chains B)
GSLLKPARFMCLPCGIAFSSPSTLEAHQAYYCSHRI

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Zinc fingers as protein recognition motifs: Structural basis for the GATA-1/Friend of GATA interaction. Liew, C.K., Simpson, R.J.Y., Kwan, A.H.Y. et al. Proc Natl Acad Sci U S A (2005) 102:583-588. DOI 10.1073/pnas.0407511102 · PubMed

Other PDB entries of the same protein (UniProt P17679 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VD6 1.98 Å, Both Zn Fingers of GATA1 Bound to Palindromic DNA Recognition Site, P21 Crystal Form
3VEK 2.63 Å, Both Zn Fingers of GATA1 Bound to Palindromic DNA Recognition Site, P1 Crystal Form
1GNF Solution structure of the N-terminal zinc finger of murine gata-1, NMR, 25 structures
2L5E Complex between BD1 of Brd3 and GATA-1 C-tail
2L6Y haddock model of GATA1NF:Lmo2LIM2-Ldb1LID
2L6Z haddock model of GATA1NF:Lmo2LIM2-Ldb1LID with FOG

Browse structure collections

About this viewer

MolViewer shows 1Y0J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.