1JN7: U-shaped TRANSCRIPTIONAL COFACTOR

Name: PDB 1JN7: Solution Structure of a CCHH mutant of the ninth CCHC Zinc Finger of U-shaped
Published: 2002-09-25
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Solution Structure of a CCHH mutant of the ninth CCHC Zinc Finger of U-shaped. Determined by solution NMR. Released 25 Sept 2002.

Method: Solution NMR
Organism: Drosophila melanogaster
Chains: 1
Atoms: 296
Mol. weight: 4.28 kDa
Ligands: ZN
Released: 25 Sept 2002

Explore 1JN7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JN7 contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	1
β-strand	16-17	2	1
α-helix	21-30	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
U-shaped TRANSCRIPTIONAL COFACTOR	A	protein	36	Drosophila melanogaster	Q9VPQ6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1JN7_1 U-shaped TRANSCRIPTIONAL COFACTOR (chains A)
GSAAEVMKKYCSTCDISFNYVKTYLAHKQFYHKNKP

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Characterization of the Conserved Interaction between GATA and FOG Family Proteins. Kowalski, K., Liew, C.K., Matthews, J.M. et al. J Biol Chem (2002) 277:35720-35729. DOI 10.1074/jbc.M204663200 · PubMed

Other PDB entries of the same protein (UniProt Q9VPQ6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FU9 Solution structure of the ninth zinc-finger domain of the U-shaped transcription factor
1FV5 Solution structure of the first zinc finger from the drosophila U-shaped transcription…
1Y0J Zinc fingers as protein recognition motifs: structural basis for the GATA-1/Friend of…
2L6Z haddock model of GATA1NF:Lmo2LIM2-Ldb1LID with FOG

Browse structure collections

About this viewer

MolViewer shows 1JN7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.