1FVY: Parathyroid hormone

Solution structure of the osteogenic 1-31 fragment of the human parathyroid hormone. Determined by solution NMR. Released 22 Nov 2000.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 260
Mol. weight: 3.73 kDa
Released: 22 Nov 2000

Explore 1FVY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FVY contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7
α-helix	19-29	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Parathyroid hormone	A	protein	31	Homo sapiens	P01270 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1FVY_1 PARATHYROID HORMONE (chains A)
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV

Primary citation

Solution structure of the osteogenic 1-31 fragment of the human parathyroid hormone. Chen, Z., Xu, P., Barbier, J.R. et al. Biochemistry (2000) 39:12766-12777. DOI 10.1021/bi000882e · PubMed

Other PDB entries of the same protein (UniProt P01270 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ET1 0.9 Å, Crystal structure of human parathyroid hormone 1-34 at 0.9 a resolution
3C4M 1.95 Å, Structure of human parathyroid hormone in complex with the extracellular domain of its…
8T5F 1.99 Å, De novo design of high-affinity protein binders to bioactive helical peptides
8FLQ 2.55 Å, Human PTH1R in complex with PTH(1-34) and Gs
8HA0 2.62 Å, Molecular recognition of two endogenous hormones by the human parathyroid hormone…
7VVL 2.8 Å, PTH-bound human PTH1R in complex with Gs (class2)
7Y36 2.8 Å, Cryo-EM structure of the Teriparatide-bound human PTH1R-Gs complex
9JR2 2.8 Å, Cryo-EM structure of PTH-PTH1R-Gq (upright state)
9JR3 2.8 Å, Cryo-EM structure of PTH-PTH1R-Gq (tilted state)
7VVM 3.2 Å, PTH-bound human PTH1R in complex with Gs (class3)
7VVK 3.3 Å, PTH-bound human PTH1R in complex with Gs (class1)
8HAO 3.76 Å, Human parathyroid hormone receptor-1 dimer

Browse structure collections

About this viewer

MolViewer shows 1FVY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.