1FZQ: Murine ARL3-GDP

Crystal structure of murine ARL3-GDP. Determined by X-ray diffraction at 1.7 Å resolution. Released 6 Dec 2000.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,628
Mol. weight: 21.23 kDa
Ligands: GDP
Released: 6 Dec 2000

Explore 1FZQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FZQ contains 13 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
α-helix	17	1
β-strand	18-24	7	1
α-helix	30-37	8
α-helix	41-42	2
β-strand	43-48	6	1
β-strand	51-58	8	1
β-strand	61-67	7	1
α-helix	72-74	3
α-helix	75-82	8
β-strand	87-93	7	1
α-helix	97-99	3
α-helix	100-110	11
α-helix	114-116	3
β-strand	121-126	6	1
α-helix	133-135	3
α-helix	136-142	7
α-helix	145-147	3
β-strand	153-157	5	1
α-helix	166-175	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor-like protein 3	A	protein	181	Mus musculus	Q9WUL7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1FZQ_1 ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 3 (chains A)
GLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGF
KLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPV
LIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKK
K

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1

Water and common crystallization additives (SO4, NH4, MES) are not listed.

Primary citation

Structural and biochemical properties show ARL3-GDP as a distinct GTP binding protein. Hillig, R.C., Hanzal-Bayer, M., Linari, M. et al. Structure (2000) 8:1239-1245. DOI 10.1016/S0969-2126(00)00531-1 · PubMed

Other PDB entries of the same protein (UniProt Q9WUL7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BH7 1.9 Å, Crystal structure of the RP2-Arl3 complex bound to GDP-AlF4
4ZI3 2.0 Å, BART-like domain of BARTL1/CCDC104 aa1-133 in complex with Arl3FL bound to GppNHp in P1…
4GOJ 2.1 Å, The Crystal Structure of full length Arl3GppNHp in complex with UNC119a
4ZI2 2.2 Å, BART-like domain of BARTL1/CCDC104 in complex with Arl3FL bound to GppNHp in P21 21 21
3BH6 2.6 Å, Crystal structure of the RP2-Arl3 complex bound to GppNHp
7OK7 3.15 Å, Crystal structure of the UNC119B ARL3 complex

Browse structure collections

About this viewer

MolViewer shows 1FZQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.