4GOJ: Full length Arl3GppNHp

The Crystal Structure of full length Arl3GppNHp in complex with UNC119a. Determined by X-ray diffraction at 2.1 Å resolution. Released 19 Sept 2012.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 5,712
Mol. weight: 98.02 kDa
Ligands: MG, GNP
Released: 19 Sept 2012

Explore 4GOJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GOJ contains 30 α-helices and 30 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	4-10	7
β-strand	17-23	7	1
α-helix	30-37	8
β-strand	51-58	8	1
β-strand	61-68	8	1
α-helix	75-81	7
β-strand	87-93	7	1
α-helix	97-99	3
α-helix	100-110	11
α-helix	114-116	3
β-strand	121-126	6	1
α-helix	133-135	3
α-helix	136-142	7
α-helix	145-147	3
β-strand	153-157	5	1
α-helix	166-175	10

Chain B: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8
β-strand	17-23	7	2
α-helix	30-37	8
β-strand	51-58	8	2
β-strand	61-68	8	2
α-helix	75-81	7
β-strand	87-93	7	2
α-helix	97-99	3
α-helix	100-110	11
α-helix	114-116	3
β-strand	121-126	6	2
α-helix	133-135	3
α-helix	136-143	8
α-helix	145-147	3
β-strand	153-157	5	2
α-helix	166-175	10

Chain C: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	62-64	3
α-helix	79-81	3
β-strand	87-95	9	1
β-strand	101-106	6	1
β-strand	128-133	6	3
α-helix	135-139	5
β-strand	142-150	9	1
β-strand	156-167	12	3
β-strand	170-182	13	3
β-strand	187-195	9	1
α-helix	196-197	2
α-helix	201-209	9
β-strand	214-222	9	3
β-strand	225-236	12	3

Chain D: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	62-66	5
α-helix	79-81	3
β-strand	87-95	9	2
β-strand	101-106	6	2
β-strand	128-133	6	4
α-helix	135-139	5
β-strand	142-150	9	2
β-strand	156-167	12	4
β-strand	170-182	13	4
β-strand	187-195	9	2
α-helix	196-198	3
α-helix	201-208	8
β-strand	214-222	9	4
β-strand	225-236	12	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor-like protein 3	A, B	protein	189	Mus musculus	Q9WUL7 (AlphaFold model)
Protein unc-119 homolog A	C, D	protein	240	Homo sapiens	Q13432 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4GOJ_1 ADP-ribosylation factor-like protein 3 (chains A, B)
MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQG
FKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVP
VLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAK
KKEHHHHHH

Sequence of entity 2 (C, D), FASTA

>4GOJ_2 Protein unc-119 homolog A (chains C, D)
MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPI
GPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRD
LDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFG
FCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	2

Primary citation

Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119. Ismail, S.A., Chen, Y.X., Miertzschke, M. et al. EMBO J (2012) 31:4085-4094. DOI 10.1038/emboj.2012.257 · PubMed

Other PDB entries of the same protein (UniProt Q9WUL7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FZQ 1.7 Å, Crystal structure of murine ARL3-GDP
3BH7 1.9 Å, Crystal structure of the RP2-Arl3 complex bound to GDP-AlF4
4ZI3 2.0 Å, BART-like domain of BARTL1/CCDC104 aa1-133 in complex with Arl3FL bound to GppNHp in P1…
4ZI2 2.2 Å, BART-like domain of BARTL1/CCDC104 in complex with Arl3FL bound to GppNHp in P21 21 21
3BH6 2.6 Å, Crystal structure of the RP2-Arl3 complex bound to GppNHp
7OK7 3.15 Å, Crystal structure of the UNC119B ARL3 complex

Browse structure collections

About this viewer

MolViewer shows 4GOJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.