BART-like domain of BARTL1/CCDC104 in complex with Arl3FL bound to GppNHp in P21 21 21. Determined by X-ray diffraction at 2.2 Å resolution. Released 11 Nov 2015.
Explore 4ZI2 in 3D Show helices and sheets RCSB PDB PDBe
4ZI2 contains 40 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-10 | 5 | |
| α-helix | 14-16 | 3 | |
| β-strand | 17-24 | 8 | 1 |
| α-helix | 30-37 | 8 | |
| β-strand | 51-58 | 8 | 1 |
| β-strand | 61-68 | 8 | 1 |
| α-helix | 75-81 | 7 | |
| β-strand | 87-93 | 7 | 1 |
| α-helix | 97-99 | 3 | |
| α-helix | 100-110 | 11 | |
| α-helix | 114-116 | 3 | |
| β-strand | 121-126 | 6 | 1 |
| α-helix | 133-135 | 3 | |
| α-helix | 136-142 | 7 | |
| α-helix | 145-147 | 3 | |
| β-strand | 153-157 | 5 | 1 |
| α-helix | 166-175 | 10 | |
| α-helix | 179-186 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-10 | 6 | |
| β-strand | 17-24 | 8 | 2 |
| α-helix | 30-37 | 8 | |
| β-strand | 51-57 | 7 | 2 |
| β-strand | 62-68 | 7 | 2 |
| α-helix | 75-81 | 7 | |
| β-strand | 87-93 | 7 | 2 |
| α-helix | 97-99 | 3 | |
| α-helix | 100-112 | 13 | |
| α-helix | 114-116 | 3 | |
| β-strand | 121-126 | 6 | 2 |
| α-helix | 133-135 | 3 | |
| α-helix | 136-143 | 8 | |
| α-helix | 145-147 | 3 | |
| β-strand | 153-157 | 5 | 2 |
| α-helix | 166-175 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-21 | 19 | |
| α-helix | 23-36 | 14 | |
| α-helix | 37-39 | 3 | |
| β-strand | 46 | 1 | 1 |
| α-helix | 47 | 1 | |
| α-helix | 48-72 | 25 | |
| α-helix | 76-84 | 9 | |
| α-helix | 87-90 | 4 | |
| α-helix | 94-104 | 11 | |
| α-helix | 106-130 | 25 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-21 | 15 | |
| α-helix | 23-36 | 14 | |
| α-helix | 37-39 | 3 | |
| β-strand | 46 | 1 | 2 |
| α-helix | 47 | 1 | |
| α-helix | 48-72 | 25 | |
| α-helix | 76-84 | 9 | |
| α-helix | 87-90 | 4 | |
| α-helix | 94-104 | 11 | |
| α-helix | 106-128 | 23 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ADP-ribosylation factor-like protein 3 | A, B | protein | 190 | Mus musculus | Q9WUL7 (AlphaFold model) |
| Cilia- and flagella-associated protein 36 | C, D | protein | 135 | Mus musculus | Q8C6E0 (AlphaFold model) |
>4ZI2_1 ADP-ribosylation factor-like protein 3 (chains A, B) MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQG FKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVP VLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAK KKLEHHHHHH
>4ZI2_2 Cilia- and flagella-associated protein 36 (chains C, D) GPMAAEEEDEVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYK ELVEKLLESYLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNI EMQLQAIRIIQERNG
| ID | Name | Formula | Copies |
|---|---|---|---|
| GNP | Phosphoaminophosphonic acid-guanylate ester | C10 H17 N6 O13 P3 | 2 |
| MG | Magnesium ion | Mg | 2 |
The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function. Lokaj, M., Kosling, S.K., Koerner, C. et al. Structure (2015) 23:2122-2132. DOI 10.1016/j.str.2015.08.016 · PubMed
Other PDB entries of the same protein (UniProt Q9WUL7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4ZI2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.