1G2B: Spectrin alpha chain

Alpha-spectrin src homology 3 domain, circular permutant, cut at N47-D48. Determined by X-ray diffraction at 1.12 Å resolution. Released 1 Nov 2000.

Method: X-ray diffraction
Resolution: 1.12 Å
Organism: Gallus gallus
Chains: 1
Atoms: 699
Mol. weight: 7.42 kDa
Released: 1 Nov 2000

Explore 1G2B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1G2B contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	49-54	6	1
α-helix	55-57	3
β-strand	58-60	3	1
α-helix	61-2	3
β-strand	8-11	4	1
β-strand	15	1	2
β-strand	22	1	1
β-strand	25	1	2
β-strand	30-35	6	1
β-strand	41-46	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spectrin alpha chain	A	protein	62	Gallus gallus	P07751 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1G2B_1 SPECTRIN ALPHA CHAIN (chains A)
MDRQGFVPAAYVKKLDSGTGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVE
VN

Primary citation

Atomic resolution structure of a mutant of the spectrin SH3 domain. Berisio, R., Viguera, A., Serrano, L. et al. Acta Crystallogr D Biol Crystallogr (2001) 57:337-340. DOI 10.1107/S090744490001581X · PubMed

Other PDB entries of the same protein (UniProt P07751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9IHA 1.01 Å, A-spectrin SH3 domain V9L, A11V, M25V, V46F, V58L mutant
9EYC 1.06 Å, A-spectrin SH3 domain V9L, A11V, V23L, M25C, V46W, V53L and V58L mutant
3NGP 1.08 Å, High resolution structure of alpha-spectrin SH3 domain mutant with a redesigned core
3M0R 1.1 Å, Crystal Structure of the R21D mutant of alpha-spectrin SH3 domain. Crystal obtained in…
3M0U 1.1 Å, Crystal Structure of the R21D mutant of alpha-spectrin SH3 domain. Hexagonal crystal…
9IH7 1.12 Å, A-spectrin SH3 domain V9L, A11V, V23I, M25V, V46F, V53L, V58L mutant
9EYE 1.13 Å, A-spectrin SH3 domain V9L, A11V, L31V, V44I, V53I mutant
9IH6 1.31 Å, A-spectrin SH3 domain V9Y, A11V, V23L, M25V, V53L, V58L mutant
9EYB 1.34 Å, A-spectrin SH3 domain V9L, A11V, V23L, M25C, V46W, V53L and V58L mutant
9EYF 1.34 Å, A-spectrin SH3 domain V9L, A11V, V23L, M25L, V46Y, V53I mutant
5IHK 1.35 Å, Crystal Structure of the alpha spectrin SH3 domain mutant N47A
3I9Q 1.45 Å, Crystal Structure of the triple mutant S19G-P20D-R21S of alpha spectrin SH3 domain

Browse structure collections

About this viewer

MolViewer shows 1G2B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.