Crystal Structure of the triple mutant S19G-P20D-R21S of alpha spectrin SH3 domain. Determined by X-ray diffraction at 1.45 Å resolution. Released 15 Dec 2009.
Explore 3I9Q in 3D Show helices and sheets RCSB PDB PDBe
3I9Q contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-11 | 4 | 1 |
| β-strand | 15 | 1 | 2 |
| β-strand | 22 | 1 | 1 |
| β-strand | 25 | 1 | 2 |
| β-strand | 30-35 | 6 | 1 |
| β-strand | 41-46 | 6 | 1 |
| β-strand | 49-54 | 6 | 1 |
| α-helix | 55-57 | 3 | |
| β-strand | 58-60 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Spectrin alpha chain | A | protein | 57 | Gallus gallus | P07751 (AlphaFold model) |
>3I9Q_1 Spectrin alpha chain (chains A) KELVLALYDYQEKGDSEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
The effect of a proline residue on the rate of growth and the space group of alpha-spectrin SH3-domain crystals. Camara-Artigas, A., Andujar-Sanchez, M., Ortiz-Salmeron, E. et al. Acta Crystallogr D Biol Crystallogr (2009) 65:1247-1252. DOI 10.1107/S0907444909038037 · PubMed
Other PDB entries of the same protein (UniProt P07751 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3I9Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.