Crystal Structure of the R21D mutant of alpha-spectrin SH3 domain. Hexagonal crystal obtained in sodium formate at pH 6.5. Determined by X-ray diffraction at 1.1 Å resolution. Released 19 Jan 2011.
Explore 3M0U in 3D Show helices and sheets RCSB PDB PDBe
3M0U contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-11 | 4 | 1 |
| β-strand | 15 | 1 | 2 |
| β-strand | 22 | 1 | 1 |
| β-strand | 25 | 1 | 2 |
| β-strand | 30-35 | 6 | 1 |
| β-strand | 41-46 | 6 | 1 |
| β-strand | 49-54 | 6 | 1 |
| α-helix | 55-57 | 3 | |
| β-strand | 58-61 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Spectrin alpha chain, brain | A | protein | 62 | Gallus gallus | P07751 (AlphaFold model) |
>3M0U_1 Spectrin alpha chain, brain (chains A) MDETGKELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKK LD
Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures. Camara-Artigas, A., Gavira, J.A., Casares, S. et al. Acta Crystallogr D Biol Crystallogr (2011).
Other PDB entries of the same protein (UniProt P07751 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3M0U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.