1G2F: CYS2HIS2 zinc finger/tata box complex

Structure of a CYS2HIS2 zinc finger/tata box complex (tatazf;clone #6). Determined by X-ray diffraction at 2.0 Å resolution. Released 7 Sept 2001.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Mus musculus
Chains: 6
Atoms: 2,980
Mol. weight: 41.25 kDa
Ligands: ZN
Released: 7 Sept 2001

Explore 1G2F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1G2F contains 8 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	105-106	2	1
β-strand	115-116	2	1
α-helix	119-130	12
β-strand	135-136	2	2
β-strand	143-144	2	2
α-helix	147-158	12
β-strand	163-164	2	3
β-strand	171-172	2	3
α-helix	175-182	8
α-helix	183-186	4

Chain F: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	205-206	2	4
β-strand	215-216	2	4
α-helix	219-230	12
β-strand	235-236	2	5
β-strand	243-244	2	5
α-helix	247-258	12
β-strand	263-264	2	6
β-strand	271-272	2	6
α-helix	275-282	8
α-helix	283-285	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(gpapcpgpcptpaptpapapapapgpgpapg)-3'	A, D	DNA	16
5'-d(tpcpcptptptptpaptpapgpcpgptpcpc)-3'	B, E	DNA	16
Tata box zinc finger protein	C, F	protein	90	Mus musculus	P08046 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>1G2F_1 5'-D(*GP*AP*CP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*AP*G)-3' (chains A, D)
GACGCTATAAAAGGAG

Sequence of entity 2 (B, E), FASTA

>1G2F_2 5'-D(*TP*CP*CP*TP*TP*TP*TP*AP*TP*AP*GP*CP*GP*TP*CP*C)-3' (chains B, E)
TCCTTTTATAGCGTCC

Sequence of entity 3 (C, F), FASTA

>1G2F_3 TATA BOX ZINC FINGER PROTEIN (chains C, F)
MERPYACPVESCDRRFSQKTNLDTHIRIHTGQKPFQCRICMRNFSQQASLNAHIRTHTGE
KPFACDICGRKFATLHTRTRHTKIHLRQKD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	6

Primary citation

Beyond the "recognition code": structures of two Cys2His2 zinc finger/TATA box complexes. Wolfe, S.A., Grant, R.A., Elrod-Erickson, M. et al. Structure (2001) 9:717-723. DOI 10.1016/S0969-2126(01)00632-3 · PubMed

Other PDB entries of the same protein (UniProt P08046 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LLM 1.5 Å, Crystal Structure of a Zif23-GCN4 Chimera Bound to DNA
1A1H 1.6 Å, Qgsr (ZIF268 variant) zinc finger-DNA complex (gcac site)
1A1I 1.6 Å, Radr (ZIF268 variant) zinc finger-DNA complex (gcac site)
1AAY 1.6 Å, ZIF268 zinc finger-DNA complex
1JK2 1.65 Å, Zif268 D20A mutant bound to the GCT DNA site
1A1G 1.9 Å, Dsnr (ZIF268 variant) zinc finger-DNA complex (gcgt site)
1A1K 1.9 Å, Radr (ZIF268 variant) zinc finger-DNA complex (gacc site)
1JK1 1.9 Å, Zif268 D20A Mutant Bound to WT DNA Site
1A1J 2.0 Å, Radr (ZIF268 variant) zinc finger-DNA complex (gcgt site)
1A1F 2.1 Å, Dsnr (ZIF268 variant) zinc finger-DNA complex (gacc site)
1ZAA 2.1 Å, Zinc finger-DNA recognition: crystal structure of a ZIF268-DNA complex at 2.1 Å
1G2D 2.2 Å, Structure of a CYS2HIS2 zinc finger/tata box complex (clone #2)

Browse structure collections

About this viewer

MolViewer shows 1G2F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.