1G4K: Stromelysin-1

X-ray Structure of a Novel Matrix Metalloproteinase Inhibitor Complexed to Stromelysin. Determined by X-ray diffraction at 2.0 Å resolution. Released 25 Apr 2001.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,294
Mol. weight: 58.44 kDa
Ligands: ZN, CA, HQQ
Released: 25 Apr 2001

Explore 1G4K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1G4K contains 11 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	85	1	1
β-strand	96-101	6	2
α-helix	110-125	16
β-strand	131-134	4	2
β-strand	142-147	6	2
β-strand	165-167	3	2
β-strand	178-181	4	2
β-strand	186-187	2	3
β-strand	193-194	2	3
α-helix	195-207	13
β-strand	209	1	1
α-helix	229-231	3
α-helix	236-246	11

Chain B: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	85	1	4
β-strand	96-101	6	5
α-helix	110-125	16
β-strand	131-134	4	5
β-strand	142-147	6	5
β-strand	165-167	3	5
β-strand	178-181	4	5
β-strand	186-187	2	6
β-strand	193-194	2	6
α-helix	195-206	12
β-strand	209	1	4
α-helix	229-231	3
α-helix	236-246	11

Chain C: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	84-85	2	7
β-strand	96-101	6	8
α-helix	110-125	16
β-strand	131-134	4	8
β-strand	142-147	6	8
β-strand	165-167	3	8
β-strand	178-181	4	8
β-strand	186-187	2	9
β-strand	193-194	2	9
α-helix	195-206	12
β-strand	209-210	2	7
α-helix	236-246	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stromelysin-1	A, B, C	protein	168	Homo sapiens	P08254 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1G4K_1 STROMELYSIN-1 (chains A, B, C)
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADI
MISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHE
IGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPP

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	6
CA	Calcium ion	Ca	9
HQQ	5-methyl-5-(4-phenoxy-phenyl)-pyrimidine-2,4,6-trione	C17 H14 N2 O4	3

Water and common crystallization additives (GOL) are not listed.

Primary citation

X-ray structure of a novel matrix metalloproteinase inhibitor complexed to stromelysin. Dunten, P., Kammlott, U., Crowther, R. et al. Protein Sci (2001) 10:923-926. DOI 10.1110/ps.48401 · PubMed

Other PDB entries of the same protein (UniProt P08254 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HY7 1.5 Å, A carboxylic acid based inhibitor in complex with MMP3
1CIZ 1.64 Å, X-ray structure of human stromelysin catalytic domain complexes with non-peptide…
1HFS 1.7 Å, Crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited…
1CAQ 1.8 Å, X-ray structure of human stromelysin catalytic domain complexes with non-peptide…
1USN 1.8 Å, Crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited…
1C3I 1.83 Å, Human stromelysin-1 catalytic domain complexed with ro-26-2812
4G9L 1.88 Å, Structure of MMP3 complexed with NNGH inhibitor.
1G49 1.9 Å, A carboxylic acid based inhibitor in complex with MMP3
1SLM 1.9 Å, Crystal structure of fibroblast stromelysin-1: the C-truncated human proenzyme
4DPE 1.96 Å, Structure of MMP3 complexed with a platinum-based inhibitor.
4JA1 1.96 Å, Structure of MMP3 complexed with a platinum-based inhibitor
1B8Y 2.0 Å, X-ray structure of human stromelysin catalytic domain complexed with non-peptide…

Browse structure collections

About this viewer

MolViewer shows 1G4K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.