1GCQ: Vav and GRB2 SH3 domains

Crystal structure of vav and GRB2 SH3 domains. Determined by X-ray diffraction at 1.68 Å resolution. Released 8 Aug 2001.

Method: X-ray diffraction
Resolution: 1.68 Å
Organisms: Homo sapiens, Mus musculus
Chains: 3
Atoms: 1,678
Mol. weight: 22.15 kDa
Ligands: MRD
Released: 8 Aug 2001

Explore 1GCQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GCQ contains 6 α-helices and 24 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	159-163	5	1
β-strand	167	1	2
β-strand	174	1	1
β-strand	177	1	2
β-strand	182-187	6	1
β-strand	193-198	6	1
β-strand	201-206	6	1
α-helix	207-209	3
β-strand	210-212	3	1

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	160-163	4	3
β-strand	167	1	4
β-strand	174	1	3
α-helix	175-176	2
β-strand	177	1	4
β-strand	182-187	6	3
β-strand	193-198	6	3
β-strand	201-206	6	3
α-helix	207-209	3
β-strand	210-212	3	3

Chain C: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	596-599	4	5
β-strand	603	1	6
α-helix	608-609	2
α-helix	610-612	3
β-strand	616	1	5
β-strand	619	1	6
β-strand	624-629	6	5
β-strand	636-641	6	5
β-strand	646-651	6	5
α-helix	652-654	3
β-strand	655-657	3	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Growth factor receptor-bound protein 2	A, B	protein	61	Homo sapiens	P62993 (AlphaFold model)
Vav proto-oncogene	C	protein	70	Mus musculus	P27870 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1GCQ_1 GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2 (chains A, B)
GSTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRN
V

Sequence of entity 2 (C), FASTA

>1GCQ_2 VAV PROTO-ONCOGENE (chains C)
GSHMPKMEVFQEYYGIPPPPGAFGPFLRLNPGDIVELTKAEAEHNWWEGRNTATNEVGWF
PCNRVHPYVH

Ligands and cofactors

ID	Name	Formula	Copies
MRD	(4R)-2-methylpentane-2,4-diol	C6 H14 O2	1

Primary citation

Novel recognition mode between Vav and Grb2 SH3 domains. Nishida, M., Nagata, K., Hachimori, Y. et al. EMBO J (2001) 20:2995-3007. DOI 10.1093/emboj/20.12.2995 · PubMed

Other PDB entries of the same protein (UniProt P62993 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ICG 1.15 Å, Grb2 SH2 domain in phosphopeptide free form
3WA4 1.35 Å, Grb2 SH2 domain/CD28-derived peptide complex
1JYR 1.55 Å, Xray Structure of Grb2 SH2 Domain Complexed with a Phosphorylated Peptide
2VWF 1.58 Å, Grb2 SH3C (2)
2VVK 1.6 Å, Grb2 SH3C (1)
3OV1 1.6 Å, Crystal Structure of the Grb2 SH2 Domain in Complex with a pYXN-Derived Tripeptide
4P9V 1.64 Å, Grb2 SH2 complexed with a pTyr-Ac6cN-Asn tripeptide
2W0Z 1.7 Å, Grb2 SH3C (3)
3C7I 1.7 Å, X-RAY crystal structure of the complex between the grb2-sh2 domain and a flexible…
3IN8 1.7 Å, Crystal Structure of the Grb2 SH2 Domain in Complex with a Flexible Ac-pTyr-Ile-Asn-NH2…
3S8L 1.71 Å, Protein-Ligand Interactions: Thermodynamic Effects Associated with Increasing…
3S8N 1.71 Å, Crystal Structure of the Grb2 SH2 Domain in Complex with a pYXN-Derived Tripeptide

Browse structure collections

About this viewer

MolViewer shows 1GCQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.