A trichosanthin(tcs) MUTANT(E85Q) complex structure with 2'-deoxy-adenosin-5'-monophosphate. Determined by X-ray diffraction at 1.7 Å resolution. Released 3 Jun 2003.
Explore 1GIS in 3D Show helices and sheets RCSB PDB PDBe
1GIS contains 16 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 1 |
| α-helix | 12-25 | 14 | |
| β-strand | 28-32 | 5 | 2 |
| β-strand | 35-38 | 4 | 2 |
| α-helix | 39 | 1 | |
| α-helix | 44-47 | 4 | |
| β-strand | 48-54 | 7 | 1 |
| β-strand | 60-66 | 7 | 1 |
| β-strand | 71-77 | 7 | 1 |
| β-strand | 80-83 | 4 | 1 |
| α-helix | 87-92 | 6 | |
| β-strand | 102-105 | 4 | 1 |
| α-helix | 106 | 1 | |
| α-helix | 112-119 | 8 | |
| α-helix | 123-125 | 3 | |
| β-strand | 128 | 1 | 3 |
| α-helix | 130-141 | 12 | |
| α-helix | 148-156 | 9 | |
| α-helix | 157-161 | 5 | |
| α-helix | 162-164 | 3 | |
| β-strand | 165 | 1 | 4 |
| α-helix | 166-173 | 8 | |
| β-strand | 180 | 1 | 3 |
| α-helix | 181-183 | 3 | |
| α-helix | 184-204 | 21 | |
| β-strand | 209-217 | 9 | 5 |
| β-strand | 223-228 | 6 | 5 |
| α-helix | 232-236 | 5 | |
| β-strand | 238 | 1 | 4 |
| β-strand | 241 | 1 | 2 |
| α-helix | 244-246 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ribosome-inactivating protein alpha-trichosanthin | A | protein | 248 | Trichosanthes kirilowii | P09989 (AlphaFold model) |
>1GIS_1 RIBOSOME-INACTIVATING PROTEIN ALPHA-TRICHOSANTHIN (chains A) MDVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADET ISVAIDVTNVYIMGYRAGDTSYFFNQASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAG KIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTF LPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIAL LLNRNNMA
| ID | Name | Formula | Copies |
|---|---|---|---|
| D5M | 2'-deoxyadenosine-5'-monophosphate | C10 H14 N5 O6 P | 1 |
Substrate binding and catalysis in trichosanthin occur in different sites as revealed by the complex structures of several E85 mutants. Guo, Q., Zhou, W., Too, H.M. et al. Protein Eng (2003) 16:391-396. DOI 10.1093/protein/gzg056 · PubMed
Other PDB entries of the same protein (UniProt P09989 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1GIS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.