1GLA: Glucose-specific protein iiiglc

Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase. Determined by X-ray diffraction at 2.6 Å resolution. Released 31 Oct 1993.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Escherichia coli
Chains: 2
Atoms: 4,985
Mol. weight: 74.4 kDa
Released: 31 Oct 1993

Explore 1GLA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GLA contains 23 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain F: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	20-23	4	1
β-strand	28-31	4	2
α-helix	33-35	3
α-helix	39-42	4
β-strand	48-50	3	3
β-strand	51-54	4	2
β-strand	58-60	3	4
β-strand	65-70	6	3
β-strand	76-81	6	3
β-strand	86-90	5	3
β-strand	93	1	5
α-helix	95-98	4
β-strand	103-105	3	4
β-strand	112-113	2	3
β-strand	118-122	5	4
α-helix	124-130	7
β-strand	133	1	5
β-strand	138-140	3	3
β-strand	148-151	4	1
β-strand	155-156	2	2
β-strand	162-167	6	1

Chain G: 19 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	5-11	7	6
β-strand	15-21	7	6
β-strand	27-34	8	6
β-strand	38	1	7
β-strand	46-47	2	7
α-helix	49-67	19
β-strand	74-81	8	6
β-strand	86	1	7
β-strand	87-90	4	8
β-strand	96	1	8
β-strand	100-101	2	7
α-helix	109-118	10
α-helix	121-128	8
α-helix	137-147	11
α-helix	151-154	4
β-strand	160-163	4	8
α-helix	165-173	9
β-strand	180-182	3	9
α-helix	183-187	5
β-strand	192	1	10
β-strand	199	1	10
α-helix	203-206	4
β-strand	216-218	3	9
β-strand	221-226	6	6
β-strand	238-244	7	6
α-helix	247-252	6
β-strand	260-265	6	11
β-strand	269-274	6	11
α-helix	280-282	3
β-strand	287-292	6	11
β-strand	298-306	9	11
α-helix	310-318	9
α-helix	328-333	6
β-strand	343-345	3	12
β-strand	348	1	13
β-strand	350	1	13
β-strand	352	1	11
β-strand	356	1	11
β-strand	363-365	3	12
α-helix	373-399	27
β-strand	406-407	2	14
β-strand	408-410	3	11
α-helix	411-414	4
α-helix	416-426	11
β-strand	430-433	4	14
α-helix	439-451	13
α-helix	457-460	4
β-strand	466-470	5	14
α-helix	474-478	5
α-helix	479-493	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glucose-specific protein iiiglc	F	protein	168	Escherichia coli	P69783 (AlphaFold model)
Glycerol kinase	G	protein	501	Escherichia coli	P0A6F3 (AlphaFold model)

Sequence of entity 1 (F), FASTA

>1GLA_1 GLUCOSE-SPECIFIC PROTEIN IIIGlc (chains F)
GLFDKLKSLVSDDKKDTGTIEIIAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPTGNKMV
APVDGTIGKIFETNHAFSIESDSGVELFVHFGIDTVELKGEGFKRIAEEGQRVKVGDTVI
EFDLPLLEEKAKSTLTPVVISNMDEIKELIKLSGSVTVGETPVIRIKK

Sequence of entity 2 (G), FASTA

>1GLA_2 GLYCEROL KINASE (chains G)
TEKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPMEIWATQSSTL
VEVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGL
EDYIRSNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVHV
TDYTNASRTMLFNIHTLDWDDKMLEVLDIPREMLPEVRRSSEVYGQTNIGGKGGTRIPIS
GIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPTGEVNY
ALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDPYA
RGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLMQ
FQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTERN
YRYAGWKKAVKRAMAWEEHDE

Primary citation

Structure of the regulatory complex of Escherichia coli IIIGlc with glycerol kinase. Hurley, J.H., Faber, H.R., Worthylake, D. et al. Science (1993) 259:673-677. PubMed

Other PDB entries of the same protein (UniProt P69783 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1F3Z 1.98 Å, Iiaglc-ZN complex
1F3G 2.1 Å, Three-dimensional structure of the escherichia coli phosphocarrier protein III glc
2F3G 2.13 Å, Iiaglc crystal form III
1GLB 2.6 Å, Structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase
1GLC 2.65 Å, Cation promoted association (CPA) of a regulatory and target protein is controlled by…
1GLD 2.93 Å, Cation promoted association (CPA) of a regulatory and target protein is controlled by…
1GLE 2.94 Å, Cation promoted association (CPA) of a regulatory and target protein is controlled by…
4JBW 3.91 Å, Crystal structure of E. coli maltose transporter MalFGK2 in complex with its regulatory…
1GGR Complex of enzyme iiaglc and the histidine-containing phosphocarrier protein hpr from…
1O2F Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli…
2MP0 Protein Phosphorylation upon a Fleeting Encounter

Browse structure collections

About this viewer

MolViewer shows 1GLA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.