Cation promoted association (CPA) of a regulatory and target protein is controlled by phosphorylation. Determined by X-ray diffraction at 2.93 Å resolution. Released 31 May 1994.
Explore 1GLD in 3D Show helices and sheets RCSB PDB PDBe
1GLD contains 30 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-9 | 3 | |
| β-strand | 20-23 | 4 | 1 |
| α-helix | 24 | 1 | |
| β-strand | 28-32 | 5 | 2 |
| α-helix | 33-35 | 3 | |
| α-helix | 39-42 | 4 | |
| β-strand | 48-54 | 7 | 2 |
| β-strand | 58-60 | 3 | 3 |
| β-strand | 65-70 | 6 | 2 |
| β-strand | 76-81 | 6 | 2 |
| β-strand | 86-90 | 5 | 2 |
| α-helix | 95-98 | 4 | |
| β-strand | 103-105 | 3 | 3 |
| β-strand | 112-113 | 2 | 2 |
| β-strand | 118-122 | 5 | 3 |
| α-helix | 126-130 | 5 | |
| β-strand | 138-140 | 3 | 2 |
| α-helix | 143-145 | 3 | |
| β-strand | 148-151 | 4 | 1 |
| β-strand | 155-156 | 2 | 2 |
| β-strand | 162-167 | 6 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-11 | 7 | 4 |
| β-strand | 15-22 | 8 | 4 |
| β-strand | 27-34 | 8 | 4 |
| β-strand | 37-38 | 2 | 5 |
| β-strand | 46-47 | 2 | 5 |
| α-helix | 49-67 | 19 | |
| α-helix | 71-73 | 3 | |
| β-strand | 74-81 | 8 | 4 |
| β-strand | 86-90 | 5 | 5 |
| β-strand | 95-96 | 2 | 5 |
| β-strand | 100-101 | 2 | 5 |
| α-helix | 102 | 1 | |
| α-helix | 109-118 | 10 | |
| α-helix | 120-128 | 9 | |
| α-helix | 137-146 | 10 | |
| α-helix | 152-153 | 2 | |
| α-helix | 154-158 | 5 | |
| β-strand | 160-164 | 5 | 5 |
| α-helix | 165-173 | 9 | |
| β-strand | 180-182 | 3 | 6 |
| α-helix | 183-186 | 4 | |
| α-helix | 187-189 | 3 | |
| β-strand | 192-193 | 2 | 7 |
| β-strand | 198-199 | 2 | 7 |
| α-helix | 201-206 | 6 | |
| β-strand | 216-218 | 3 | 6 |
| β-strand | 221-226 | 6 | 4 |
| β-strand | 238-244 | 7 | 4 |
| α-helix | 245-252 | 8 | |
| β-strand | 261-265 | 5 | 8 |
| β-strand | 269-274 | 6 | 8 |
| α-helix | 280-282 | 3 | |
| β-strand | 287-292 | 6 | 8 |
| β-strand | 298-306 | 9 | 8 |
| α-helix | 310-318 | 9 | |
| α-helix | 328-334 | 7 | |
| β-strand | 343-345 | 3 | 9 |
| β-strand | 348 | 1 | 10 |
| β-strand | 350 | 1 | 10 |
| β-strand | 351 | 1 | 11 |
| β-strand | 357 | 1 | 11 |
| β-strand | 363-365 | 3 | 9 |
| α-helix | 373-399 | 27 | |
| β-strand | 405-410 | 6 | 8 |
| α-helix | 412-414 | 3 | |
| α-helix | 416-426 | 11 | |
| β-strand | 429-433 | 5 | 8 |
| α-helix | 438-449 | 12 | |
| α-helix | 457-460 | 4 | |
| β-strand | 466-470 | 5 | 8 |
| α-helix | 474-477 | 4 | |
| α-helix | 479-493 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glucose-specific protein iiiglc | F | protein | 168 | Escherichia coli | P69783 (AlphaFold model) |
| Glycerol kinase | G | protein | 501 | Escherichia coli | P0A6F3 (AlphaFold model) |
>1GLD_1 GLUCOSE-SPECIFIC PROTEIN IIIGlc (chains F) GLFDKLKSLVSDDKKDTGTIEIIAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPTGNKMV APVDGTIGKIFETNHAFSIESDSGVELFVHFGIDTVELKGEGFKRIAEEGQRVKVGDTVI EFDLPLLEEKAKSTLTPVVISNMDEIKELIKLSGSVTVGETPVIRIKK
>1GLD_2 GLYCEROL KINASE (chains G) TEKKYIVALDQGTTSSRAVVMDHDANIISVSQREFEQIYPKPGWVEHDPMEIWATQSSTL VEVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTAEICEHLKRDGL EDYIRSNTGLVIDPYFSGTKVKWILDHVEGSRERARRGELLFGTVDTWLIWKMTQGRVHV TDYTNASRTMLFNIHTLDWDDKMLEVLDIPREMLPEVRRSSEVYGQTNIGGKGGTRIPIS GIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPTGEVNY ALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFTGLGAPYWDPYA RGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLMQ FQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTERN YRYAGWKKAVKRAMAWEEHDE
| ID | Name | Formula | Copies |
|---|---|---|---|
| MN | Manganese (II) ion | Mn | 1 |
| G3H | Glyceraldehyde-3-phosphate | C3 H7 O6 P | 1 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
Cation-promoted association of a regulatory and target protein is controlled by protein phosphorylation. Feese, M., Pettigrew, D.W., Meadow, N.D. et al. Proc Natl Acad Sci U S A (1994) 91:3544-3548. DOI 10.1073/pnas.91.9.3544 · PubMed
Other PDB entries of the same protein (UniProt P69783 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1GLD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.