1GOZ: Enterotoxin type B

Name: PDB 1GOZ: Structural basis for the altered T-cell receptor binding specificty in a superantigenic staphylococcus aureus Enterotoxin-B mutant
Published: 2002-02-13
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: enterotoxin

Structural basis for the altered T-cell receptor binding specificty in a superantigenic staphylococcus aureus Enterotoxin-B mutant. Determined by X-ray diffraction at 2.0 Å resolution. Released 13 Feb 2002.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: STAPHYLOCOCCUS AUREUS
Chains: 2
Atoms: 3,972
Mol. weight: 56.79 kDa
Released: 13 Feb 2002

Explore 1GOZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GOZ contains 17 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	1003-1007	5
α-helix	1012-1013	2
α-helix	1014-1016	3
β-strand	1017	1	1
α-helix	1022-1025	4
β-strand	1033-1038	6	2
β-strand	1042	1	3
β-strand	1048-1055	8	3
β-strand	1060-1067	8	3
α-helix	1071-1077	7
β-strand	1082-1086	5	2
β-strand	1089	1	3
β-strand	1111-1115	5	3
β-strand	1118-1120	3	2
β-strand	1125-1138	14	4
β-strand	1141-1152	12	4
β-strand	1154-1156	3	5
α-helix	1157-1172	16
β-strand	1182-1191	10	4
β-strand	1194-1199	6	4
α-helix	1202-1203	2
β-strand	1205	1	1
α-helix	1210-1214	5
α-helix	1215-1219	5
β-strand	1222-1224	3	5
β-strand	1229-1236	8	4

Chain B: 8 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	2002-2007	6
α-helix	2014-2016	3
β-strand	2017	1	6
α-helix	2022-2025	4
β-strand	2033-2038	6	7
β-strand	2042	1	8
β-strand	2048-2054	7	8
β-strand	2061-2067	7	8
α-helix	2071-2077	7
β-strand	2082-2086	5	7
β-strand	2089	1	8
β-strand	2111-2115	5	8
β-strand	2118-2120	3	7
β-strand	2125-2138	14	9
β-strand	2141-2152	12	9
β-strand	2154-2156	3	10
α-helix	2157-2172	16
β-strand	2182-2191	10	9
β-strand	2195-2199	5	9
α-helix	2202-2203	2
β-strand	2205	1	6
α-helix	2210-2214	5
α-helix	2215-2217	3
β-strand	2222-2224	3	10
β-strand	2228-2236	9	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Enterotoxin type B	A, B	protein	239	STAPHYLOCOCCUS AUREUS	P01552 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1GOZ_1 ENTEROTOXIN TYPE B (chains A, B)
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGN
YDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKSCMYGGVTE
HNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNS
PYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK

Primary citation

Structural and Functional Role of Threonine 112 in a Superantigen Staphylococcus Aureus Enterotoxin B. Baker, M.D., Papageorgiou, A.C., Titball, R. et al. J Biol Chem (2002) 277:2756. DOI 10.1074/JBC.M109369200 · PubMed

Other PDB entries of the same protein (UniProt P01552 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SEB 1.48 Å, Staphylococcal enterotoxin B
8YBO 1.59 Å, Crystal structure of nanobody SEB-Nb11 bound to staphylococcal enterotoxin B (SEB)
4RGO 1.8 Å, Structure of Staphylococcal Enterotoxin B bound to the neutralizing antibody 14G8
1SE4 1.9 Å, Staphylococcal enterotoxin B complexed with lactose
3GP7 1.9 Å, Staphylococcal Enterotoxin B mutant N23YK97SK98S
1D5M 2.0 Å, X-ray crystal structure of HLA-DR4 complexed with peptide and seb
1D5Z 2.0 Å, X-ray crystal structure of HLA-DR4 complexed with peptidomimetic and seb
8YBM 2.04 Å, Crystal structure of nanobody SEB-Nb6 bound to staphylococcal enterotoxin B (SEB)
8YKT 2.04 Å, Fab and SEB complex
8YBP 2.08 Å, Crystal structure of nanobody SEB-Nb20 bound to staphylococcal enterotoxin B (SEB)
8YBN 2.18 Å, Crystal structure of nanobody SEB-Nb8 bound to staphylococcal enterotoxin B (SEB)
1SE3 2.3 Å, Staphylococcal enterotoxin B complexed with GM3 trisaccharide

Browse structure collections

About this viewer

MolViewer shows 1GOZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.