Crystal structure of nanobody SEB-Nb8 bound to staphylococcal enterotoxin B (SEB). Determined by X-ray diffraction at 2.18 Å resolution. Released 25 Dec 2024.
Explore 8YBN in 3D Show helices and sheets RCSB PDB PDBe
8YBN contains 15 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-9 | 4 | |
| α-helix | 16-18 | 3 | |
| β-strand | 19 | 1 | 1 |
| α-helix | 24-27 | 4 | |
| α-helix | 28-30 | 3 | |
| β-strand | 35-41 | 7 | 2 |
| β-strand | 44 | 1 | 3 |
| β-strand | 50-56 | 7 | 3 |
| β-strand | 63-69 | 7 | 3 |
| α-helix | 73-79 | 7 | |
| β-strand | 83-88 | 6 | 2 |
| β-strand | 91 | 1 | 3 |
| β-strand | 113-117 | 5 | 3 |
| β-strand | 120-122 | 3 | 2 |
| β-strand | 127-140 | 14 | 4 |
| β-strand | 143-154 | 12 | 4 |
| β-strand | 156-158 | 3 | 5 |
| α-helix | 159-174 | 16 | |
| β-strand | 184-193 | 10 | 4 |
| β-strand | 196-201 | 6 | 4 |
| α-helix | 204-205 | 2 | |
| β-strand | 207 | 1 | 1 |
| α-helix | 212-216 | 5 | |
| α-helix | 217-219 | 3 | |
| β-strand | 224-226 | 3 | 5 |
| β-strand | 230-238 | 9 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 6 |
| β-strand | 10-13 | 4 | 7 |
| β-strand | 18-25 | 8 | 6 |
| β-strand | 33-39 | 7 | 7 |
| β-strand | 46-52 | 7 | 7 |
| β-strand | 57-60 | 4 | 7 |
| α-helix | 62-64 | 3 | |
| β-strand | 68-73 | 6 | 6 |
| α-helix | 74-76 | 3 | |
| β-strand | 78-83 | 6 | 6 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-98 | 7 | 7 |
| α-helix | 99-100 | 2 | |
| α-helix | 109-111 | 3 | |
| α-helix | 115-117 | 3 | |
| β-strand | 120-121 | 2 | 7 |
| β-strand | 125-130 | 6 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Enterotoxin type B | A | protein | 240 | Staphylococcus aureus | P01552 (AlphaFold model) |
| nanobody SEB-Nb8 | B | protein | 131 | Vicugna pacos |
>8YBN_1 Enterotoxin type B (chains A) MESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLG NYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVT EHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNN SPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
>8YBN_2 nanobody SEB-Nb8 (chains B) QVQLVESGGGSVQDGGSLRLSCAASGFTIDNRWMTWFRQAPGKEREGVASILTYSGRTVY ADSGKGRFTISQANAKNSVYLQMNSLKPEDTATYYCAAGDAYHKWFMPSSRALDRKEYNY WGQGTLVTVSS
Structural insights into the binding of nanobodies to the Staphylococcal enterotoxin B. Zong, X., Liu, P., Wang, Z. et al. Int J Biol Macromol (2024) 276:133957-133957. DOI 10.1016/j.ijbiomac.2024.133957 · PubMed
Other PDB entries of the same protein (UniProt P01552 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8YBN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.