8YBP: Nanobody SEB-Nb20

Crystal structure of nanobody SEB-Nb20 bound to staphylococcal enterotoxin B (SEB). Determined by X-ray diffraction at 2.08 Å resolution. Released 25 Dec 2024.

Method: X-ray diffraction
Resolution: 2.08 Å
Organisms: Staphylococcus aureus, Vicugna pacos
Chains: 2
Atoms: 2,891
Mol. weight: 41.92 kDa
Released: 25 Dec 2024

Explore 8YBP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8YBP contains 13 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
α-helix	14-15	2
α-helix	16-18	3
β-strand	19	1	1
α-helix	24-27	4
β-strand	35-40	6	2
β-strand	44-46	3	3
β-strand	50-56	7	3
β-strand	63-69	7	3
α-helix	73-80	8
β-strand	84-88	5	2
β-strand	91	1	3
β-strand	113-117	5	3
β-strand	120-122	3	2
β-strand	127-140	14	4
β-strand	143-154	12	4
β-strand	156-158	3	5
α-helix	159-174	16
β-strand	184-193	10	4
β-strand	196-201	6	4
α-helix	204-205	2
β-strand	207	1	1
α-helix	212-216	5
α-helix	217-221	5
β-strand	224-226	3	5
β-strand	231-238	8	4

Chain B: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	6
β-strand	11-13	3	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	32-39	8	8
β-strand	46-50	5	8
β-strand	56-57	2	8
β-strand	65-70	6	6
β-strand	75-80	6	6
α-helix	85-87	3
β-strand	89-97	9	8
α-helix	98-100	3
α-helix	108-110	3
β-strand	113-114	2	8
β-strand	118-120	3	8
β-strand	121-123	3	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Enterotoxin type B	A	protein	240	Staphylococcus aureus	P01552 (AlphaFold model)
nanobody SEB-Nb20	B	protein	124	Vicugna pacos

Sequence of entity 1 (A), FASTA

>8YBP_1 Enterotoxin type B (chains A)
MESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLG
NYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVT
EHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNN
SPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK

Sequence of entity 2 (B), FASTA

>8YBP_2 nanobody SEB-Nb20 (chains B)
QVQLVESGGGSVQAGGSLRLSCAASGSTVSAYYMAWFRQAPGKGREGVAVIGGSGVYADA
VKGRFTISQDNAKNTLYLQMNSLKPEDTAMYYCAAYWKGYKYHPKFDDSAYEYWGQGTQV
TVSS

Primary citation

Structural insights into the binding of nanobodies to the Staphylococcal enterotoxin B. Zong, X., Liu, P., Wang, Z. et al. Int J Biol Macromol (2024) 276:133957-133957. DOI 10.1016/j.ijbiomac.2024.133957 · PubMed

Other PDB entries of the same protein (UniProt P01552 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SEB 1.48 Å, Staphylococcal enterotoxin B
8YBO 1.59 Å, Crystal structure of nanobody SEB-Nb11 bound to staphylococcal enterotoxin B (SEB)
4RGO 1.8 Å, Structure of Staphylococcal Enterotoxin B bound to the neutralizing antibody 14G8
1SE4 1.9 Å, Staphylococcal enterotoxin B complexed with lactose
3GP7 1.9 Å, Staphylococcal Enterotoxin B mutant N23YK97SK98S
1D5M 2.0 Å, X-ray crystal structure of HLA-DR4 complexed with peptide and seb
1D5Z 2.0 Å, X-ray crystal structure of HLA-DR4 complexed with peptidomimetic and seb
1GOZ 2.0 Å, Structural basis for the altered T-cell receptor binding specificty in a superantigenic…
8YBM 2.04 Å, Crystal structure of nanobody SEB-Nb6 bound to staphylococcal enterotoxin B (SEB)
8YKT 2.04 Å, Fab and SEB complex
8YBN 2.18 Å, Crystal structure of nanobody SEB-Nb8 bound to staphylococcal enterotoxin B (SEB)
1SE3 2.3 Å, Staphylococcal enterotoxin B complexed with GM3 trisaccharide

Browse structure collections

About this viewer

MolViewer shows 8YBP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.