3SEB: Staphylococcal enterotoxin B

Name: PDB 3SEB: Staphylococcal enterotoxin B
Published: 1998-05-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Staphylococcal enterotoxin B. Determined by X-ray diffraction at 1.48 Å resolution. Released 27 May 1998.

Method: X-ray diffraction
Resolution: 1.48 Å
Organism: Staphylococcus aureus
Chains: 1
Atoms: 2,125
Mol. weight: 28.28 kDa
Released: 27 May 1998

Explore 3SEB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3SEB contains 10 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
α-helix	3-5	3
α-helix	10-13	4
α-helix	14-16	3
β-strand	17	1	2
α-helix	22-25	4
α-helix	26-28	3
β-strand	33-39	7	3
β-strand	42	1	4
β-strand	48-51	4	4
β-strand	63-67	5	4
α-helix	71-77	7
β-strand	81-86	6	3
β-strand	89	1	4
β-strand	111-115	5	4
β-strand	118-120	3	3
β-strand	125-138	14	1
β-strand	141-152	12	1
β-strand	154-156	3	5
α-helix	157-172	16
β-strand	182-191	10	1
β-strand	194-199	6	1
α-helix	202-203	2
β-strand	205	1	2
α-helix	210-214	5
α-helix	215-219	5
β-strand	222-224	3	5
β-strand	228-236	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Staphylococcal enterotoxin B	A	protein	238	Staphylococcus aureus	P01552 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3SEB_1 STAPHYLOCOCCAL ENTEROTOXIN B (chains A)
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGN
YDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTE
HNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNS
PYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK

Primary citation

Crystal structure of microbial superantigen staphylococcal enterotoxin B at 1.5 A resolution: implications for superantigen recognition by MHC class II molecules and T-cell receptors. Papageorgiou, A.C., Tranter, H.S., Acharya, K.R. J Mol Biol (1998) 277:61-79. DOI 10.1006/jmbi.1997.1577 · PubMed

Other PDB entries of the same protein (UniProt P01552 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8YBO 1.59 Å, Crystal structure of nanobody SEB-Nb11 bound to staphylococcal enterotoxin B (SEB)
4RGO 1.8 Å, Structure of Staphylococcal Enterotoxin B bound to the neutralizing antibody 14G8
1SE4 1.9 Å, Staphylococcal enterotoxin B complexed with lactose
3GP7 1.9 Å, Staphylococcal Enterotoxin B mutant N23YK97SK98S
1D5M 2.0 Å, X-ray crystal structure of HLA-DR4 complexed with peptide and seb
1D5Z 2.0 Å, X-ray crystal structure of HLA-DR4 complexed with peptidomimetic and seb
1GOZ 2.0 Å, Structural basis for the altered T-cell receptor binding specificty in a superantigenic…
8YBM 2.04 Å, Crystal structure of nanobody SEB-Nb6 bound to staphylococcal enterotoxin B (SEB)
8YKT 2.04 Å, Fab and SEB complex
8YBP 2.08 Å, Crystal structure of nanobody SEB-Nb20 bound to staphylococcal enterotoxin B (SEB)
8YBN 2.18 Å, Crystal structure of nanobody SEB-Nb8 bound to staphylococcal enterotoxin B (SEB)
1SE3 2.3 Å, Staphylococcal enterotoxin B complexed with GM3 trisaccharide

Browse structure collections

About this viewer

MolViewer shows 3SEB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.