1GW3: Apoa-I

The helix-hinge-helix structural motif in human apolipoprotein a-I determined by NMR spectroscopy, 1 structure. Determined by solution NMR. Released 23 Jul 1997.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 361
Mol. weight: 5.15 kDa
Released: 23 Jul 1997

Explore 1GW3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GW3 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	14-21	8
α-helix	27-35	9
α-helix	36-38	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoa-I	A	protein	46	Homo sapiens	P02647 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1GW3_1 APOA-I (chains A)
SPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGA

Primary citation

The helix-hinge-helix structural motif in human apolipoprotein A-I determined by NMR spectroscopy. Wang, G., Sparrow, J.T., Cushley, R.J. Biochemistry (1997) 36:13657-13666. DOI 10.1021/bi971151q · PubMed

Other PDB entries of the same protein (UniProt P02647 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7KJR 2.08 Å, Cryo-EM structure of SARS-CoV-2 ORF3a
9PVY 2.15 Å, Cryo-EM structure of cardiac amyloid fibril from a variant apolipoprotein A-I L90P…
3R2P 2.2 Å, 2.2 Angstrom Crystal Structure of C Terminal Truncated Human Apolipoprotein A-I Reveals…
9PVZ 2.3 Å, Cryo-EM structure of cardiac amyloid fibril from a variant apolipoprotein A-I R173P…
8VXJ 2.7 Å, The crystal structure of human apolipoprotein A-I in complex with Fab 55201
9PW3 2.73 Å, Cryo-EM structure of renal amyloid fibril from a variant apolipoprotein A-I R173P…
8EQS 3.1 Å, Structure of SARS-CoV-1 Orf3a in late endosome/lysosome-like environment, MSP1D1 nanodisc
1AV1 4.0 Å, Crystal structure of human apolipoprotein a-I
4V6M 7.1 Å, Structure of the ribosome-SecYE complex in the membrane environment
9MXZ 9.8 Å, Lecithin:Cholesterol Acyltransferase Bound to Apolipoprotein A-I dimer in HDL
1GW4 The helix-hinge-helix structural motif in human apolipoprotein a-I determined by NMR…
1ODP Peptide of human apoa-I residues 166-185. NMR, 5 structures at PH 6.6, 37 degrees…

Browse structure collections

About this viewer

MolViewer shows 1GW3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.