1GWB: Glycoprotein 1B

Structure of glycoprotein 1B. Determined by X-ray diffraction at 2.8 Å resolution. Released 6 Feb 2003.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 4,451
Mol. weight: 64.63 kDa
Ligands: NAG, PT
Released: 6 Feb 2003

Explore 1GWB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GWB contains 8 α-helices and 31 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	22-23	2	1
β-strand	30-32	3	1
β-strand	51-53	3	1
β-strand	61-63	3	2
α-helix	64-67	4
β-strand	75-77	3	1
β-strand	85-87	3	2
β-strand	97-99	3	1
β-strand	120-122	3	1
β-strand	144-146	3	1
β-strand	168-170	3	1
β-strand	192-194	3	1
β-strand	215-217	3	1
β-strand	223	1	3
α-helix	229-238	10
α-helix	240-242	3
β-strand	243-244	2	1
α-helix	259-261	3
β-strand	263-264	2	3
β-strand	270-271	2	3

Chain B: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	21-23	3	4
β-strand	30-32	3	4
β-strand	51-53	3	4
β-strand	61-63	3	5
α-helix	64-67	4
β-strand	75-77	3	4
β-strand	85-87	3	5
β-strand	97-99	3	4
β-strand	120-122	3	4
β-strand	144-146	3	4
β-strand	168-170	3	4
β-strand	192-194	3	4
β-strand	215-217	3	4
β-strand	223	1	6
α-helix	230-238	9
α-helix	240-242	3
β-strand	243-244	2	4
α-helix	259-261	3
β-strand	264	1	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Platelet glycoprotein ib alpha chain	A, B	protein	281	HOMO SAPIENS	P07359 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1GWB_1 PLATELET GLYCOPROTEIN IB ALPHA CHAIN (chains A, B)
PHPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQ
LNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGA
LRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLL
QENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAM
TSNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYP

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3
PT	Platinum (II) ion	Pt	4

Water and common crystallization additives (SO4, ACY) are not listed.

Primary citation

Crystal Structure of the Platelet Glycoprotein Ib-Alpha N-Terminal Domain Reveals an Unmasking Mechanism of Receptor Activation. Uff, S., Clemetson, J.M., Harrison, T. et al. J Biol Chem (2002) 277:35657. DOI 10.1074/JBC.M205271200 · PubMed

Other PDB entries of the same protein (UniProt P07359 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CH2 1.6 Å, Low-salt crystal structure of a thrombin-GpIbalpha peptide complex
1P9A 1.7 Å, Crystal Structure of N-Terminal Domain of Human Platelet Receptor Glycoprotein Ib-alpha…
4CH8 1.75 Å, High-salt crystal structure of a thrombin-GpIbalpha peptide complex
1M0Z 1.85 Å, Crystal Structure of the von Willebrand Factor Binding Domain of Glycoprotein Ib alpha
3P72 1.9 Å, structure of platelet Glycoprotein 1b alpha with a bound peptide inhibitor
4C2A 2.08 Å, Crystal Structure of High-Affinity von Willebrand Factor A1 domain with R1306Q and…
8WE2 2.11 Å, 14-3-3 zeta complexed with S609 phosphorylated peptide derived from GPIb alpha…
1OOK 2.3 Å, Crystal Structure of the Complex of Platelet Receptor GPIb-alpha and Human alpha-Thrombin
2BP3 2.32 Å, Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex
4YR6 2.38 Å, Fab fragment of 5G6 in complex with epitope peptide
8WF6 2.47 Å, 14-3-3 zeta complexed with S559 phosphorylated peptide derived from GPIb alpha…
1P8V 2.6 Å, Crystal structure of the complex of platelet receptor gpib-alpha and alpha-thrombin at…

Browse structure collections

About this viewer

MolViewer shows 1GWB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.