Crystal Structure of the von Willebrand Factor Binding Domain of Glycoprotein Ib alpha. Determined by X-ray diffraction at 1.85 Å resolution. Released 28 Aug 2002.
Explore 1M0Z in 3D Show helices and sheets RCSB PDB PDBe
1M0Z contains 16 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-7 | 3 | 1 |
| β-strand | 14-16 | 3 | 1 |
| α-helix | 25-26 | 2 | |
| β-strand | 35-37 | 3 | 1 |
| β-strand | 45-47 | 3 | 2 |
| α-helix | 48-51 | 4 | |
| β-strand | 59-61 | 3 | 1 |
| β-strand | 69-71 | 3 | 2 |
| β-strand | 81-83 | 3 | 1 |
| α-helix | 92-94 | 3 | |
| β-strand | 104-106 | 3 | 1 |
| β-strand | 128-130 | 3 | 1 |
| β-strand | 152-154 | 3 | 1 |
| β-strand | 176-178 | 3 | 1 |
| β-strand | 199-201 | 3 | 1 |
| β-strand | 207 | 1 | 3 |
| α-helix | 211-213 | 3 | |
| α-helix | 214-222 | 9 | |
| α-helix | 224-226 | 3 | |
| β-strand | 227-228 | 2 | 1 |
| α-helix | 243-245 | 3 | |
| β-strand | 247 | 1 | 4 |
| β-strand | 248 | 1 | 3 |
| β-strand | 255 | 1 | 4 |
| α-helix | 256-258 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-9 | 5 | 5 |
| β-strand | 12-16 | 5 | 5 |
| α-helix | 25-26 | 2 | |
| β-strand | 35-37 | 3 | 5 |
| β-strand | 45-47 | 3 | 6 |
| α-helix | 48-51 | 4 | |
| β-strand | 59-61 | 3 | 5 |
| β-strand | 69-71 | 3 | 6 |
| β-strand | 81-83 | 3 | 5 |
| β-strand | 104-106 | 3 | 5 |
| β-strand | 128-130 | 3 | 5 |
| β-strand | 152-154 | 3 | 5 |
| β-strand | 176-178 | 3 | 5 |
| β-strand | 199-201 | 3 | 5 |
| β-strand | 207 | 1 | 7 |
| α-helix | 211-213 | 3 | |
| α-helix | 214-222 | 9 | |
| α-helix | 224-226 | 3 | |
| β-strand | 227 | 1 | 5 |
| α-helix | 243-245 | 3 | |
| β-strand | 247 | 1 | 8 |
| β-strand | 248 | 1 | 7 |
| α-helix | 251-253 | 3 | |
| β-strand | 255 | 1 | 8 |
| α-helix | 256-258 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glycoprotein Ib alpha | A, B | protein | 290 | Homo sapiens | P07359 (AlphaFold model) |
>1M0Z_1 Glycoprotein Ib alpha (chains A, B) HPICEVSKVASHLEVNCDKRQLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQL NLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGAL RGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNQLTELPAGLLNGLENLDTLLLQ ENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMT SNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYPEEDTEGDKVR
Structures of glycoprotein Ibalpha and its complex with von Willebrand factor A1 domain. Huizinga, E.G., Tsuji, S., Romijn, R.A. et al. Science (2002) 297:1176-1179. DOI 10.1126/science.107355 · PubMed
Other PDB entries of the same protein (UniProt P07359 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1M0Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.