2BP3: Filamin a

Crystal structure of Filamin A domain 17 and GPIb alpha cytoplasmic domain complex. Determined by X-ray diffraction at 2.32 Å resolution. Released 30 Nov 2005.

Method: X-ray diffraction
Resolution: 2.32 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 1,593
Mol. weight: 25.26 kDa
Released: 30 Nov 2005

Explore 2BP3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2BP3 contains 8 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	1869-1871	3	1
α-helix	1873-1875	3
β-strand	1877-1879	3	2
β-strand	1884-1889	6	1
β-strand	1896-1904	9	2
α-helix	1908	1
β-strand	1909-1914	6	1
β-strand	1919-1925	7	1
β-strand	1930-1938	9	2
β-strand	1941-1942	2	2
α-helix	1943	1
α-helix	1946	1
β-strand	1948-1953	6	2

Chains S and T: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	563-571	9	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Filamin a	A, B	protein	97	HOMO SAPIENS	P21333 (AlphaFold model)
Platelet glycoprotein ib alpha chain	S, T	protein	22	HOMO SAPIENS	P07359 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2BP3_1 FILAMIN A (chains A, B)
GAMVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGT
CSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD

Sequence of entity 2 (S, T), FASTA

>2BP3_2 PLATELET GLYCOPROTEIN IB ALPHA CHAIN (chains S, T)
LRGSLPTFRSSLFLWVRPNGRV

Primary citation

The Structure of the Gpib-Filamin a Complex. Nakamura, F., Pudas, R., Heikkinen, O. et al. Blood (2006) 107:1925. DOI 10.1182/BLOOD-2005-10-3964 · PubMed

Other PDB entries of the same protein (UniProt P21333 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CNK 1.65 Å, Crystal Structure of the dimerization domain of human filamin A
4M9P 1.72 Å, Crystal structure of the human filamin A Ig-like domains 3-5
7SC4 1.85 Å, filamin complex-1
2W0P 1.9 Å, Crystal structure of the filamin A repeat 21 complexed with the migfilin peptide
4P3W 2.0 Å, Crystal structure of the human filamin A Ig-like domains 20-21 in complex with migfilin…
2BRQ 2.1 Å, Crystal structure of the filamin A repeat 21 complexed with the integrin beta7…
2JF1 2.2 Å, Crystal structure of the filamin a repeat 21 complexed with the integrin BETA2…
9LWX 2.29 Å, Crystal structure of the Filamin A repeat 21
3HOC 2.3 Å, Structure of the actin-binding domain of human filamin A mutant E254K
3HOP 2.3 Å, Structure of the actin-binding domain of human filamin A
6EW1 2.31 Å, Crystal structure of the Filamin A Ig-like domains 3-5 mutant P637Q
3RGH 2.44 Å, Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens

Browse structure collections

About this viewer

MolViewer shows 2BP3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.