1H6P: Dimeristion domain from human TRF2

Dimeristion domain from human TRF2. Determined by X-ray diffraction at 2.2 Å resolution. Released 5 Sept 2001.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 3,057
Mol. weight: 47.36 kDa
Ligands: MG
Released: 5 Sept 2001

Explore 1H6P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1H6P contains 20 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	44-69	26
α-helix	73-86	14
α-helix	98-111	14
α-helix	128-142	15
α-helix	147-167	21
α-helix	171-181	11
α-helix	193-201	9
α-helix	214-227	14
α-helix	232-234	3
α-helix	235-244	10

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	1046-1069	24
α-helix	1073-1086	14
α-helix	1097-1112	16
α-helix	1128-1142	15
α-helix	1147-1167	21
α-helix	1171-1180	10
α-helix	1193-1201	9
α-helix	1214-1226	13
α-helix	1232-1234	3
α-helix	1235-1242	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Telomeric repeat binding factor 2	A, B	protein	203	HOMO SAPIENS	Q15554 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1H6P_1 TELOMERIC REPEAT BINDING FACTOR 2 (chains A, B)
AGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKEHTVSRLLR
VMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEAAV
IICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREKNLAHPVIQNFSYETFQQKML
RFLESHLDDAEPYLLTMAKKALK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Structure of the Trfh Dimerization Domain of the Human Telomere Proteins Trf1 and Trf2. Fairall, L., Chapman, L., Moss, H. et al. Mol Cell (2001) 8:351-361. DOI 10.1016/S1097-2765(01)00321-5 · PubMed

Other PDB entries of the same protein (UniProt Q15554 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SJM 1.35 Å, Crystal Structure Analysis of TRF2-Dbd-DNA complex
1W0U 1.8 Å, hTRF2 DNA-binding domain in complex with telomeric DNA.
3K6G 1.95 Å, Crystal structure of Rap1 and TRF2 complex
4M7C 2.05 Å, Crystal structure of the TRF2-binding motif of SLX4 in complex with the TRFH domain of…
6J67 2.05 Å, Crystal structure of the compound 34 in a complex with TRF2
3BU8 2.15 Å, Crystal Structure of TRF2 TRFH domain and TIN2 peptide complex
7C5D 2.15 Å, Crystal structure of TRF2 TRFH domain in complex with a MCPH1 peptide
5XYF 2.2 Å, Crystal structure of the human TIN2-TPP1-TRF2 telomeric complex
4RQI 2.44 Å, Structure of TRF2/RAP1 secondary interaction binding site
3BUA 2.5 Å, Crystal Structure of TRF2 TRFH domain and APOLLO peptide complex
9Q9K 2.59 Å, Cryo-EM structure of human Mre11-Rad50 (MR) complex bound to DNA and telomeric factor…
9Q9J 2.71 Å, Cryo-EM structure of human Mre11-Rad50-Nbs1 (MRN) complex bound to DNA and telomeric…

Browse structure collections

About this viewer

MolViewer shows 1H6P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.