6J67: Compound 34 in a complex with TRF2

Crystal structure of the compound 34 in a complex with TRF2. Determined by X-ray diffraction at 2.05 Å resolution. Released 13 Feb 2019.

Method: X-ray diffraction
Resolution: 2.05 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 1,876
Mol. weight: 24.59 kDa
Released: 13 Feb 2019

Explore 6J67 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6J67 contains 12 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	45-69	25
α-helix	73-86	14
α-helix	95-111	17
α-helix	128-142	15
α-helix	147-167	21
α-helix	171-181	11
α-helix	186-188	3
α-helix	189-201	13
α-helix	207-210	4
α-helix	214-226	13
α-helix	232-234	3
α-helix	235-243	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Telomeric repeat-binding factor 2	A	protein	204	Homo sapiens	Q15554 (AlphaFold model)
3FB-phe-B8R-leu-5XU-pro	C	protein	6	synthetic construct

Sequence of entity 1 (A), FASTA

>6J67_1 Telomeric repeat-binding factor 2 (chains A)
GAGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKEHTVSRLL
RVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEAA
VIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREKNLAHPVIQNFSYETFQQKM
LRFLESHLDDAEPYLLTMAKKALK

Sequence of entity 2 (C), FASTA

>6J67_2 3FB-PHE-B8R-LEU-5XU-PRO (chains C)
XFXLAP

Primary citation

Cyclic Peptidic Mimetics of Apollo Peptides Targeting Telomeric Repeat Binding Factor 2 (TRF2) and Apollo Interaction. Chen, X., Liu, L., Chen, Y. et al. ACS Med Chem Lett (2018) 9:507-511. DOI 10.1021/acsmedchemlett.8b00152 · PubMed

Other PDB entries of the same protein (UniProt Q15554 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SJM 1.35 Å, Crystal Structure Analysis of TRF2-Dbd-DNA complex
1W0U 1.8 Å, hTRF2 DNA-binding domain in complex with telomeric DNA.
3K6G 1.95 Å, Crystal structure of Rap1 and TRF2 complex
4M7C 2.05 Å, Crystal structure of the TRF2-binding motif of SLX4 in complex with the TRFH domain of…
3BU8 2.15 Å, Crystal Structure of TRF2 TRFH domain and TIN2 peptide complex
7C5D 2.15 Å, Crystal structure of TRF2 TRFH domain in complex with a MCPH1 peptide
1H6P 2.2 Å, Dimeristion domain from human TRF2
5XYF 2.2 Å, Crystal structure of the human TIN2-TPP1-TRF2 telomeric complex
4RQI 2.44 Å, Structure of TRF2/RAP1 secondary interaction binding site
3BUA 2.5 Å, Crystal Structure of TRF2 TRFH domain and APOLLO peptide complex
9Q9K 2.59 Å, Cryo-EM structure of human Mre11-Rad50 (MR) complex bound to DNA and telomeric factor…
9Q9J 2.71 Å, Cryo-EM structure of human Mre11-Rad50-Nbs1 (MRN) complex bound to DNA and telomeric…

Browse structure collections

About this viewer

MolViewer shows 6J67 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.