1H89: Ternary protein-DNA COMPLEX2

Crystal structure of ternary protein-DNA COMPLEX2. Determined by X-ray diffraction at 2.45 Å resolution. Released 28 Jan 2002.

Method: X-ray diffraction
Resolution: 2.45 Å
Organisms: HOMO SAPIENS, MUS MUSCULUS, Homo sapiens
Chains: 5
Atoms: 3,265
Mol. weight: 50.87 kDa
Released: 28 Jan 2002

Explore 1H89 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1H89 contains 14 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	274-332	59

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	274-331	58

Chain C: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	78-81	4
α-helix	82-86	5
α-helix	94-96	3
α-helix	97-110	14
α-helix	115-120	6
α-helix	127-133	7
α-helix	134-138	5
α-helix	146-148	3
α-helix	149-162	14
α-helix	166-170	5
α-helix	178-184	7
α-helix	185-189	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Caat/enhancer binding protein beta	A, B	protein	64	HOMO SAPIENS	P17676 (AlphaFold model)
Myb proto-oncogene protein	C	protein	159	MUS MUSCULUS	P06876 (AlphaFold model)
DNA(5'-(gpaptpgptpgpgpcpgpcpap aptpcpcptptpapapcpgpgpapcptpg)-3')	D	DNA	26	Homo sapiens
DNA(5'-(cpcpapgptpcpcpgptptpap apgpgpaptptpgpcpgpcpcpapcpapt)-3')	E	DNA	26	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>1H89_1 CAAT/ENHANCER BINDING PROTEIN BETA (chains A, B)
EYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
QLPE

Sequence of entity 2 (C), FASTA

>1H89_2 MYB PROTO-ONCOGENE PROTEIN (chains C)
MGHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGP
WTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRI
IYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV

Sequence of entity 3 (D), FASTA

>1H89_3 DNA(5'-(*GP*AP*TP*GP*TP*GP*GP*CP*GP*CP*AP* AP*TP*CP*CP*TP*TP*AP*AP*CP*GP*GP*AP*CP*TP*G)-3') (chains D)
GATGTGGCGCAATCCTTAACGGACTG

Sequence of entity 4 (E), FASTA

>1H89_4 DNA(5'-(*CP*CP*AP*GP*TP*CP*CP*GP*TP*TP*AP* AP*GP*GP*AP*TP*TP*GP*CP*GP*CP*CP*AP*CP*AP*T)-3') (chains E)
CCAGTCCGTTAAGGATTGCGCCACAT

Primary citation

Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter. Tahirov, T.H., Sato, K., Ichikawa-Iwata, E. et al. Cell (2002) 108:57. DOI 10.1016/S0092-8674(01)00636-5 · PubMed

Other PDB entries of the same protein (UniProt P17676 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MG1 1.75 Å, C-terminal bZIP domain of human C/EBPbeta with 16bp Methylated Oligonucleotide…
7L4V 1.75 Å, C-terminal bZIP domain of human C/EBPbeta Bound to DNA with Consensus Recognition with…
1GU4 1.8 Å, Crystal structure of C/EBPBETA BZIP homodimer bound to a high affinity DNA fragment
2E42 1.8 Å, Crystal structure of C/EBPbeta Bzip homodimer V285A mutant bound to A High Affinity DNA…
1GTW 1.85 Å, crystal structure of C/EBPbeta bZip homodimer bound to a DNA fragment from the tom-1A…
6MG2 1.93 Å, C-terminal bZIP domain of human C/EBPbeta with 16bp Methylated Oligonucleotide…
6MG3 2.05 Å, V285A Mutant of the C-terminal bZIP domain of human C/EBPbeta with 16bp Methylated…
1GU5 2.1 Å, Crystal structure of C/EBPBETA BZIP homodimer bound to a DNA fragment from the MIM-1…
2E43 2.1 Å, Crystal structure of C/EBPbeta Bzip homodimer K269A mutant bound to A High Affinity DNA…
8K8D 2.2 Å, Crystal structure of C/EBPbeta BZIP domain bound to a high affinity DNA
1H8A 2.23 Å, Crystal structure of ternary protein-DNA COMPLEX3
7UPZ 2.49 Å, Structural basis for cell type specific DNA binding of C/EBPbeta: the case of cell cycle…

Browse structure collections

About this viewer

MolViewer shows 1H89 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.