1H9V: PDB entry 1H9V

Human Fc-gamma-Receptor IIa (FcgRIIa), monoclinic. Determined by X-ray diffraction at 3.0 Å resolution. Released 21 Jun 2001.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,364
Mol. weight: 19.34 kDa
Released: 21 Jun 2001

Explore 1H9V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1H9V contains 7 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4	1	1
α-helix	5	1
β-strand	6-10	5	2
β-strand	15-17	3	3
β-strand	21	1	4
β-strand	23-27	5	2
β-strand	38-41	4	5
β-strand	44-45	2	5
β-strand	53-54	2	2
β-strand	57	1	4
α-helix	60-62	3
β-strand	64-69	6	5
β-strand	74	1	1
α-helix	75-78	4
β-strand	79-81	3	5
β-strand	82-84	3	3
β-strand	88-91	4	6
β-strand	96-98	3	7
α-helix	102	1
β-strand	103-109	7	6
α-helix	110-112	3
β-strand	115-122	8	8
β-strand	128-130	3	8
β-strand	135-138	4	6
α-helix	143-145	3
β-strand	147-155	9	8
β-strand	159-161	3	8
β-strand	165-167	3	8
β-strand	168-170	3	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Low affinity immunoglobulin gamma fc receptor II-a	A	protein	172	HOMO SAPIENS	P12318 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1H9V_1 LOW AFFINITY IMMUNOGLOBULIN GAMMA FC RECEPTOR II-A (chains A)
APPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANN
NDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTF
FQNGKSQKFSRLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVP

Primary citation

Molecular Basis for Immune Complex Recognition: A Comparison of Fc-Receptor Structures. Sondermann, P., Kaiser, J., Jacob, U. J Mol Biol (2001) 309:737. DOI 10.1006/JMBI.2001.4670 · PubMed

Other PDB entries of the same protein (UniProt P12318 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RY4 1.5 Å, 1.5 Angstrom resolution structure of glycosylated fcgammariia (low-responder polymorphism)
8CHA 1.81 Å, Fc gamma RIIa 27W/131H variant ectodomain
1FCG 2.0 Å, Ectodomain of human fc gamma receptor, fcgriia
9N5P 2.01 Å, Crystal structure of human IGG2 fc fragment-fc-gamma receptor iia complex H131 variant
3RY5 2.3 Å, Three-dimensional structure of glycosylated fcgammariia (high-responder polymorphism)
9MCX 2.38 Å, Crystal structure of human IgG1 fc fragment-fc-gamma receptor iia complex H131 variant
3D5O 2.8 Å, Structural recognition and functional activation of FcrR by innate pentraxins
10FJ 3.5 Å, FcgRIIa in complex with IV.3 Fab
3RY6 3.8 Å, Complex of fcgammariia (CD32) and the FC of human IGG1

Browse structure collections

About this viewer

MolViewer shows 1H9V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.