8CHA: Fc gamma RIIa 27W/131H variant ectodomain

Fc gamma RIIa 27W/131H variant ectodomain. Determined by X-ray diffraction at 1.81 Å resolution. Released 22 May 2024.

Method: X-ray diffraction
Resolution: 1.81 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,587
Mol. weight: 25.4 kDa
Ligands: FLC, PO4, 16P, DXE
Released: 22 May 2024

Explore 8CHA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8CHA contains 7 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	5-6	2
β-strand	7	1	1
α-helix	8	1
β-strand	9-13	5	2
β-strand	18-20	3	3
β-strand	24-30	7	2
β-strand	41-44	4	4
β-strand	47-48	2	4
β-strand	56-60	5	2
α-helix	63-65	3
β-strand	67-72	6	4
β-strand	77	1	1
α-helix	78-81	4
β-strand	82-84	3	4
β-strand	85-87	3	3
β-strand	91-94	4	5
β-strand	99-101	3	6
β-strand	106-112	7	5
α-helix	113-115	3
β-strand	119-125	7	7
β-strand	128-133	6	7
β-strand	138-141	4	5
α-helix	146-148	3
β-strand	150-158	9	7
β-strand	161-164	4	7
α-helix	165-167	3
β-strand	168-170	3	7
β-strand	171-173	3	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Low affinity immunoglobulin gamma Fc region receptor II-a	A	protein	209	Homo sapiens	P12318 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8CHA_1 Low affinity immunoglobulin gamma Fc region receptor II-a (chains A)
MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTL
TCWGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVL
SEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHS
HSGDYHCTGNIGYTLFSSKPVTITVQVPS

Ligands and cofactors

ID	Name	Formula	Copies
FLC	Citrate anion	C6 H5 O7	1
PO4	Phosphate ion	O4 P	3
16P	3,6,9,12,15,18-hexaoxaicosane	C14 H30 O6	1
DXE	1,2-dimethoxyethane	C4 H10 O2	1
FWN	2-[2-(2-ethoxyethoxy)ethoxy]ethanol	C8 H18 O4	1

Water and common crystallization additives (PGE, NA) are not listed.

Primary citation

Fc gamma RIIa 27W/131H variant ectodomain. Foy, E.G., Thomsen, M., Goldman, A. et al. To be published.

Other PDB entries of the same protein (UniProt P12318 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RY4 1.5 Å, 1.5 Angstrom resolution structure of glycosylated fcgammariia (low-responder polymorphism)
1FCG 2.0 Å, Ectodomain of human fc gamma receptor, fcgriia
9N5P 2.01 Å, Crystal structure of human IGG2 fc fragment-fc-gamma receptor iia complex H131 variant
3RY5 2.3 Å, Three-dimensional structure of glycosylated fcgammariia (high-responder polymorphism)
9MCX 2.38 Å, Crystal structure of human IgG1 fc fragment-fc-gamma receptor iia complex H131 variant
3D5O 2.8 Å, Structural recognition and functional activation of FcrR by innate pentraxins
1H9V 3.0 Å, Human Fc-gamma-Receptor IIa (FcgRIIa), monoclinic
10FJ 3.5 Å, FcgRIIa in complex with IV.3 Fab
3RY6 3.8 Å, Complex of fcgammariia (CD32) and the FC of human IGG1

Browse structure collections

About this viewer

MolViewer shows 8CHA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.