Three-dimensional structure of glycosylated fcgammariia (high-responder polymorphism). Determined by X-ray diffraction at 2.3 Å resolution. Released 31 Aug 2011.
Explore 3RY5 in 3D Show helices and sheets RCSB PDB PDBe
3RY5 contains 8 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-6 | 2 | |
| β-strand | 7 | 1 | 1 |
| α-helix | 8 | 1 | |
| β-strand | 9-13 | 5 | 2 |
| β-strand | 18-20 | 3 | 3 |
| β-strand | 24-30 | 7 | 2 |
| β-strand | 41-44 | 4 | 4 |
| β-strand | 47-48 | 2 | 4 |
| β-strand | 56-60 | 5 | 2 |
| α-helix | 63-65 | 3 | |
| β-strand | 67-72 | 6 | 4 |
| β-strand | 77 | 1 | 1 |
| α-helix | 78-81 | 4 | |
| β-strand | 82-84 | 3 | 4 |
| β-strand | 85-87 | 3 | 3 |
| β-strand | 91-94 | 4 | 5 |
| β-strand | 99-100 | 2 | 6 |
| α-helix | 104-105 | 2 | |
| β-strand | 106-112 | 7 | 5 |
| α-helix | 113-115 | 3 | |
| β-strand | 119-125 | 7 | 7 |
| β-strand | 128-133 | 6 | 7 |
| β-strand | 138-141 | 4 | 5 |
| α-helix | 146-148 | 3 | |
| β-strand | 150-158 | 9 | 7 |
| β-strand | 161-164 | 4 | 7 |
| α-helix | 165-167 | 3 | |
| β-strand | 168-170 | 3 | 7 |
| β-strand | 171-172 | 2 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Low affinity immunoglobulin gamma fc region receptor II-a | A | protein | 170 | Homo sapiens | P12318 (AlphaFold model) |
>3RY5_1 LOW AFFINITY IMMUNOGLOBULIN GAMMA FC REGION RECEPTOR II-A (chains A) APPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANN NDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTF FQNGKSQKFSRLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQ
Structural Basis for Fc{gamma}RIIa Recognition of Human IgG and Formation of Inflammatory Signaling Complexes. Ramsland, P.A., Farrugia, W., Bradford, T.M. et al. J Immunol (2011) 187:3208-3217. DOI 10.4049/jimmunol.1101467 · PubMed
Other PDB entries of the same protein (UniProt P12318 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3RY5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.