1HAJ: Alpha-bungarotoxin

A beta-Hairpin Structure in a 13-mer Peptide that Binds a-Bungarotoxin with High Affinity and Neutralizes its Toxicity. Determined by solution NMR. Released 25 May 2001.

Method: Solution NMR
Organisms: BUNGARUS MULTICINCTUS, SYNTHETIC CONSTRUCT
Chains: 2
Atoms: 673
Mol. weight: 9.71 kDa
Released: 25 May 2001

Explore 1HAJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HAJ contains 1 α-helix and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	12-15	4	1
β-strand	22-30	9	2
β-strand	37-45	9	2
α-helix	53-55	3
β-strand	56-60	5	2

Chain B: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	76	1	3
β-strand	77-78	2	2
β-strand	85	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-bungarotoxin	A	protein	74	BUNGARUS MULTICINCTUS	P60615 (AlphaFold model)
Peptide	B	protein	13	SYNTHETIC CONSTRUCT

Sequence of entity 1 (A), FASTA

>1HAJ_1 ALPHA-BUNGAROTOXIN (chains A)
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCC
STDKCNPHPKQRPG

Sequence of entity 2 (B), FASTA

>1HAJ_2 PEPTIDE (chains B)
WRYYESSLEPYPD

Primary citation

A Beta-Hairpin Structure in a 13-mer Peptide that Binds Alpha-Bungarotoxin with High Affinity and Neutralizes its Toxicity. Scherf, T., Kasher, R., Balass, M. et al. Proc Natl Acad Sci U S A (2001) 98:6629. DOI 10.1073/PNAS.111164298 · PubMed

Other PDB entries of the same protein (UniProt P60615 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9FYS 1.32 Å, D11 mAbs bound to alpha-Bungarotoxin
9HUB 1.33 Å, D11 mAbs bound to alpha-Bungarotoxin at pH 7.5
1HC9 1.8 Å, alpha-bungarotoxin complexed with high affinity peptide
8VY8 2.4 Å, Recombinant alpha bungarotoxin complexed with HAP peptide
9GU1 2.48 Å, Human adult muscle nAChR in resting state in nanodisc with alpha-bungarotoxin
2ABX 2.5 Å, The crystal structure of alpha-bungarotoxin at 2.5 Å resolution. Relation to solution…
8DA1 2.67 Å, Crystal structure of Krait alpha-neurotoxin in complex with Centi-LNX-D09 antibody
6UWZ 2.69 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with alpha-bungarotoxin
9GU0 2.96 Å, Human adult muscle nAChR in resting state in detergent with alpha-bungarotoxin
1ABT NMR solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
1BXP Solution NMR structure of the complex of alpha-bungarotoxin with a library derived…
1HAA A beta-Hairpin Structure in a 13-mer Peptide that Binds a-Bungarotoxin with High…

Browse structure collections

About this viewer

MolViewer shows 1HAJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.