1HC9: Alpha-bungarotoxin

alpha-bungarotoxin complexed with high affinity peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 10 Nov 2001.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: BUNGARUS MULTICINCTUS, SYNTHETIC CONSTRUCT
Chains: 4
Atoms: 1,629
Mol. weight: 19.67 kDa
Released: 10 Nov 2001

Explore 1HC9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HC9 contains 7 α-helices and 13 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	12-15	4	1
α-helix	16-17	2
β-strand	22-28	7	2
α-helix	33-36	4
β-strand	39-45	7	2
α-helix	48-50	3
β-strand	56-60	5	2

Chain B: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	3
β-strand	12-15	4	3
α-helix	16-17	2
β-strand	22-28	7	4
α-helix	33-36	4
β-strand	39-45	7	4
α-helix	48-52	5
β-strand	56-60	5	4

Chain C: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	2
β-strand	7-11	5	2
α-helix	12	1

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-4	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-bungarotoxin isoform V31	A	protein	74	BUNGARUS MULTICINCTUS	P60616 (AlphaFold model)
Alpha-bungarotoxin isoform A31	B	protein	74	BUNGARUS MULTICINCTUS	P60615 (AlphaFold model)
Peptide inhibitor	C, D	protein	13	SYNTHETIC CONSTRUCT

Sequence of entity 1 (A), FASTA

>1HC9_1 ALPHA-BUNGAROTOXIN ISOFORM V31 (chains A)
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCC
STDKCNPHPKQRPG

Sequence of entity 2 (B), FASTA

>1HC9_2 ALPHA-BUNGAROTOXIN ISOFORM A31 (chains B)
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCC
STDKCNPHPKQRPG

Sequence of entity 3 (C, D), FASTA

>1HC9_3 PEPTIDE INHIBITOR (chains C, D)
WRYYESSLLPYPD

Primary citation

The Binding Site of Acetylcholine Receptor as Visualized in the X-Ray Structure of a Complex between Alpha-Bungarotoxin and a Mimotope Peptide. Harel, M., Kasher, R., Nicolas, A. et al. Neuron (2001) 32:265. DOI 10.1016/S0896-6273(01)00461-5 · PubMed

Other PDB entries of the same protein (UniProt P60616 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QC1 1.94 Å, Crystal structure of the extracellular domain of the nicotinic acetylcholine receptor 1…
5HBT 2.61 Å, Complex structure of Fab35 and human nAChR alpha1
4UY2 2.7 Å, Crystal structure of the complex of the extracellular domain of human alpha9 nAChR with…
5HBV 2.7 Å, Complex structure of Fab35 and mouse nAChR alpha1
7KOO 3.0 Å, Alpha-7 nicotinic acetylcholine receptor bound to alpha-bungarotoxin in a resting state
4HQP 3.51 Å, Alpha7 nicotinic receptor chimera and its complex with Alpha bungarotoxin

Browse structure collections

About this viewer

MolViewer shows 1HC9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.