8VY8: Recombinant alpha bungarotoxin

Name: PDB 8VY8: Recombinant alpha bungarotoxin complexed with HAP peptide
Published: 2024-03-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Recombinant alpha bungarotoxin complexed with HAP peptide. Determined by X-ray diffraction at 2.4 Å resolution. Released 6 Mar 2024.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Bungarus multicinctus, synthetic construct
Chains: 8
Atoms: 2,943
Mol. weight: 40.36 kDa
Released: 6 Mar 2024

Explore 8VY8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8VY8 contains 12 α-helices and 32 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	4
β-strand	12-15	4	4
α-helix	16-17	2
β-strand	22-28	7	3
α-helix	33-36	4
β-strand	39-45	7	3
β-strand	47	1	2
α-helix	48-52	5
β-strand	56-60	5	3

Chains C, D, F and H: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	3
β-strand	7	1	3

Chain E: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	5
β-strand	8-9	2	6
β-strand	12-15	4	5
α-helix	16-17	2
β-strand	22-28	7	7
α-helix	33-36	4
β-strand	39-45	7	7
α-helix	48-52	5
β-strand	56-60	5	7

Chain G: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	6
β-strand	8-9	2	5
β-strand	12-15	4	6
α-helix	16-17	2
β-strand	22-28	7	8
α-helix	33-36	4
β-strand	39-45	7	8
α-helix	48-50	3
β-strand	56-60	5	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-bungarotoxin isoform V31	A, B, E, G	protein	76	Bungarus multicinctus	P60615 (AlphaFold model)
HAP peptide	C, D, F, H	protein	13	synthetic construct

Sequence of entity 1 (A, B, E, G), FASTA

>8VY8_1 Alpha-bungarotoxin isoform V31 (chains A, B, E, G)
MGIVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVT
CCSTDKCNPHPKQRPG

Sequence of entity 2 (C, D, F, H), FASTA

>8VY8_2 HAP peptide (chains C, D, F, H)
WRYYESSLLPYPD

Primary citation

Scalable production of recombinant three-finger proteins: from inclusion bodies to high quality molecular probes. Xu, J., Lei, X., Li, A. et al. Microb Cell Fact (2024) 23:48-48. DOI 10.1186/s12934-024-02316-1 · PubMed

Other PDB entries of the same protein (UniProt P60615 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9FYS 1.32 Å, D11 mAbs bound to alpha-Bungarotoxin
9HUB 1.33 Å, D11 mAbs bound to alpha-Bungarotoxin at pH 7.5
1HC9 1.8 Å, alpha-bungarotoxin complexed with high affinity peptide
9GU1 2.48 Å, Human adult muscle nAChR in resting state in nanodisc with alpha-bungarotoxin
2ABX 2.5 Å, The crystal structure of alpha-bungarotoxin at 2.5 Å resolution. Relation to solution…
8DA1 2.67 Å, Crystal structure of Krait alpha-neurotoxin in complex with Centi-LNX-D09 antibody
6UWZ 2.69 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with alpha-bungarotoxin
9GU0 2.96 Å, Human adult muscle nAChR in resting state in detergent with alpha-bungarotoxin
1ABT NMR solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
1BXP Solution NMR structure of the complex of alpha-bungarotoxin with a library derived…
1HAA A beta-Hairpin Structure in a 13-mer Peptide that Binds a-Bungarotoxin with High…
1HAJ A beta-Hairpin Structure in a 13-mer Peptide that Binds a-Bungarotoxin with High…

Browse structure collections

About this viewer

MolViewer shows 8VY8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.