Heterogeneous nuclear ribonucleoprotein D0 (hnrnp D0 RBD1), NMR. Determined by solution NMR. Released 18 May 2000.
Explore 1HD0 in 3D Show helices and sheets RCSB PDB PDBe
1HD0 contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 99-102 | 4 | 1 |
| α-helix | 110-118 | 9 | |
| β-strand | 123-127 | 5 | 1 |
| β-strand | 131 | 1 | 2 |
| β-strand | 136 | 1 | 2 |
| β-strand | 140-145 | 6 | 1 |
| α-helix | 148-156 | 9 | |
| β-strand | 162 | 1 | 3 |
| β-strand | 165 | 1 | 3 |
| β-strand | 168-169 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (heterogeneous nuclear ribonucleoprotein D0) | A | protein | 75 | Homo sapiens | Q14103 (AlphaFold model) |
>1HD0_1 PROTEIN (HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN D0) (chains A) KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ KEHKLNGKVIDPKRA
Structure and interactions with RNA of the N-terminal UUAG-specific RNA-binding domain of hnRNP D0. Nagata, T., Kurihara, Y., Matsuda, G. et al. J Mol Biol (1999) 287:221-237. DOI 10.1006/jmbi.1999.2616 · PubMed
Other PDB entries of the same protein (UniProt Q14103 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1HD0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.