1HD0: Protein

Heterogeneous nuclear ribonucleoprotein D0 (hnrnp D0 RBD1), NMR. Determined by solution NMR. Released 18 May 2000.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 601
Mol. weight: 8.57 kDa
Released: 18 May 2000

Explore 1HD0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HD0 contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	99-102	4	1
α-helix	110-118	9
β-strand	123-127	5	1
β-strand	131	1	2
β-strand	136	1	2
β-strand	140-145	6	1
α-helix	148-156	9
β-strand	162	1	3
β-strand	165	1	3
β-strand	168-169	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (heterogeneous nuclear ribonucleoprotein D0)	A	protein	75	Homo sapiens	Q14103 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HD0_1 PROTEIN (HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN D0) (chains A)
KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ
KEHKLNGKVIDPKRA

Primary citation

Structure and interactions with RNA of the N-terminal UUAG-specific RNA-binding domain of hnRNP D0. Nagata, T., Kurihara, Y., Matsuda, G. et al. J Mol Biol (1999) 287:221-237. DOI 10.1006/jmbi.1999.2616 · PubMed

Other PDB entries of the same protein (UniProt Q14103 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5IM0 1.7 Å, Crystal structure of the RNA recognition motif of mRNA decay regulator AUF1
2Z5N 3.2 Å, Complex of Transportin 1 with hnRNP D NLS
1HD1 Heterogeneous nuclear ribonucleoprotein D0 (hnrnp D0 RBD1), NMR
1IQT Solution structure of the C-terminal RNA-binding domain of heterogeneous nuclear…
1WTB Complex structure of the C-terminal RNA-binding domain of hnRNP D (AUF1) with telomere DNA
1X0F Complex structure of the C-terminal RNA-binding domain of hnRNP D(AUF1) with telomeric DNA

Browse structure collections

About this viewer

MolViewer shows 1HD0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.