Solution structure of the C-terminal RNA-binding domain of heterogeneous nuclear ribonucleoprotein D0 (AUF1). Determined by solution NMR. Released 7 Aug 2002.
Explore 1IQT in 3D Show helices and sheets RCSB PDB PDBe
1IQT contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 184-186 | 3 | 1 |
| α-helix | 195-198 | 4 | |
| α-helix | 199-203 | 5 | |
| α-helix | 204-205 | 2 | |
| β-strand | 210-211 | 2 | 1 |
| β-strand | 226-229 | 4 | 1 |
| α-helix | 234-240 | 7 | |
| β-strand | 247 | 1 | 2 |
| β-strand | 250 | 1 | 2 |
| β-strand | 254-256 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| heterogeneous nuclear ribonucleoprotein D0 | A | protein | 75 | Homo sapiens | Q14103 (AlphaFold model) |
>1IQT_1 heterogeneous nuclear ribonucleoprotein D0 (chains A) KIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEK KYHNVGLSKCEIKVA
Structure of the C-terminal RNA-binding domain of hnRNP D0 (AUF1), its interactions with RNA and DNA, and change in backbone dynamics upon complex formation with DNA. Katahira, M., Miyanoiri, Y., Enokizono, Y. et al. J Mol Biol (2001) 311:973-988. DOI 10.1006/jmbi.2001.4862 · PubMed
Other PDB entries of the same protein (UniProt Q14103 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1IQT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.