1X0F: Heterogeneous nuclear ribonucleoprotein D0

Complex structure of the C-terminal RNA-binding domain of hnRNP D(AUF1) with telomeric DNA. Determined by solution NMR. Released 5 Apr 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 721
Mol. weight: 10.33 kDa
Released: 5 Apr 2005

Explore 1X0F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1X0F contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	183-187	5	1
α-helix	195-205	11
β-strand	208-212	5	1
β-strand	226-230	5	1
α-helix	234-239	6
β-strand	247	1	2
β-strand	250	1	2
β-strand	253-255	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(ptpapgpg)-3'	B	DNA	4
Heterogeneous nuclear ribonucleoprotein D0	A	protein	79	Homo sapiens	Q14103 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1X0F_1 5'-D(P*TP*AP*GP*G)-3' (chains B)
TAGG

Sequence of entity 2 (A), FASTA

>1X0F_2 Heterogeneous nuclear ribonucleoprotein D0 (chains A)
VKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIM
EKKYHNVGLSKCEIKVAMS

Primary citation

Structure of hnRNP D complexed with single-stranded telomere DNA and unfolding of the quadruplex by heterogeneous nuclear ribonucleoprotein D. Enokizono, Y., Konishi, Y., Nagata, K. et al. J Biol Chem (2005) 280:18862-18870. DOI 10.1074/jbc.M411822200 · PubMed

Other PDB entries of the same protein (UniProt Q14103 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5IM0 1.7 Å, Crystal structure of the RNA recognition motif of mRNA decay regulator AUF1
2Z5N 3.2 Å, Complex of Transportin 1 with hnRNP D NLS
1HD0 Heterogeneous nuclear ribonucleoprotein D0 (hnrnp D0 RBD1), NMR
1HD1 Heterogeneous nuclear ribonucleoprotein D0 (hnrnp D0 RBD1), NMR
1IQT Solution structure of the C-terminal RNA-binding domain of heterogeneous nuclear…
1WTB Complex structure of the C-terminal RNA-binding domain of hnRNP D (AUF1) with telomere DNA

Browse structure collections

About this viewer

MolViewer shows 1X0F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.