5IM0: Heterogeneous nuclear ribonucleoprotein D0

Crystal structure of the RNA recognition motif of mRNA decay regulator AUF1. Determined by X-ray diffraction at 1.7 Å resolution. Released 3 Aug 2016.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,543
Mol. weight: 19.66 kDa
Released: 3 Aug 2016

Explore 5IM0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5IM0 contains 7 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	78-83	6	1
α-helix	91-98	8
α-helix	99-101	3
β-strand	104-111	8	1
β-strand	118-126	9	1
α-helix	130-136	7
β-strand	141-143	3	2
β-strand	146-148	3	2
β-strand	149-152	4	1

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	78-83	6	3
α-helix	91-98	8
α-helix	99-101	3
β-strand	104-111	8	3
β-strand	118-126	9	3
α-helix	130-137	8
β-strand	142-143	2	4
β-strand	146-147	2	4
β-strand	149-152	4	3
α-helix	153-155	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heterogeneous nuclear ribonucleoprotein D0	A	protein	87	Homo sapiens	Q14103 (AlphaFold model)
Heterogeneous nuclear ribonucleoprotein D0	B	protein	82	Homo sapiens	Q14103 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5IM0_1 Heterogeneous nuclear ribonucleoprotein D0 (chains A)
MSKNEEMEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKES
ESVDKVMDQKEHKLNGKVIDPKRAKAM

Sequence of entity 2 (B), FASTA

>5IM0_2 Heterogeneous nuclear ribonucleoprotein D0 (chains B)
MEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKV
MDQKEHKLNGKVIDPKRAKAMA

Primary citation

Crystal Structure of the N-Terminal RNA Recognition Motif of mRNA Decay Regulator AUF1. Choi, Y.J., Yoon, J.H., Chang, J.H. Biomed Res Int (2016) 2016:3286191-3286191. DOI 10.1155/2016/3286191 · PubMed

Other PDB entries of the same protein (UniProt Q14103 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Z5N 3.2 Å, Complex of Transportin 1 with hnRNP D NLS
1HD0 Heterogeneous nuclear ribonucleoprotein D0 (hnrnp D0 RBD1), NMR
1HD1 Heterogeneous nuclear ribonucleoprotein D0 (hnrnp D0 RBD1), NMR
1IQT Solution structure of the C-terminal RNA-binding domain of heterogeneous nuclear…
1WTB Complex structure of the C-terminal RNA-binding domain of hnRNP D (AUF1) with telomere DNA
1X0F Complex structure of the C-terminal RNA-binding domain of hnRNP D(AUF1) with telomeric DNA

Browse structure collections

About this viewer

MolViewer shows 5IM0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.